SecReT6
Protein ID: 194735863
SecReT6 ID295
T6SS typei3
Gene symbol-
Locus tagSeSA_A0322
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconchromosome [GenBank: NC_011094] [Browse all T6SS(s) in this replicon]
Location [Strand]332051..334243 [+]
ProductRhs-family protein
NoteTssI
UniProt IDB4TYJ6
KEGG IDsew:SeSA_A0322
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-80, Aligned region: 123..430
Phage_base_V [PF04717], Evalue: 2.20E-26, Aligned region: 468..560
Phage_base_V [PF04717], Evalue: 2.20E-26, Aligned region: 664..686
Protein Sequence: 730 a.a.     [Download]
>gi|194735863|ref|YP_002113306.1| Rhs-family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MSFVSTNNKSGMGGLTTTTPPITGENSGTTAGSVAGSVAGAAEAAVEQALGSLMGDLPEPSGLVKAAVAA
AAQAAAAAGAAQDVISALISGATSGPGAHNVTVSGSAVPPQMLLFSSLNGSEALGSLFTYIVQLKTPDTL
NLGYVSPAANLPLKAMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWVKLLTHTSD
YKAFQNKTVVDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHT
LVLADAISTHHACPDSPEVEWHQKGLKLDKAFIHTIIANESLRTGQWVLDDFDFKKPRSRLANTVANPRE
TGHASYEHYEWPGDYFDKGEGEMLTRIRMEAQRSPGSRVHGAGNIRTLMTGYTFALMNHPTAELNQEYLL
AQTTLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQEIWTDQYGRV
KVQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPW
GLPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHAEKDLNTTVKNNETHTVMVDRTKTIIKNET
NSIGEDRNTTVTKNDGLSVKLAQTINIGTTYRLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHTSDV
MQLIGKGIDMNPDGGTAVTADDIAPLPTSE
 
Nucleotide Sequence: 2193 bp     [Download]
>gi|194733902|ref|NC_011094.1|:332051-334243 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 chromosome, complete genome
ATGAGTTTTGTATCCACAAATAATAAATCCGGTATGGGGGGGCTGACGACAACCACGCCGCCGATAACAG
GTGAAAACAGTGGAACTACAGCAGGTTCGGTTGCCGGAAGCGTGGCGGGAGCCGCAGAAGCGGCAGTGGA
ACAGGCGCTGGGATCTCTGATGGGCGACCTGCCTGAACCGTCGGGGTTGGTGAAAGCAGCGGTGGCTGCG
GCGGCACAGGCTGCGGCAGCGGCGGGCGCGGCGCAGGATGTGATATCGGCACTAATTTCTGGTGCAACCA
GCGGGCCGGGCGCACATAACGTGACGGTCAGCGGCAGCGCAGTTCCACCGCAGATGCTGCTGTTTTCCAG
TCTGAACGGCTCGGAAGCTCTCGGTAGCTTGTTTACCTACATCGTACAGCTAAAAACGCCCGACACCCTG
AATCTGGGCTATGTCTCCCCCGCAGCCAACCTGCCGCTTAAAGCCATGGTGGGCAAAGATTTGTGCGTCA
ACATCGAACTGGATGGCGGCGGCAAACGGCATATCAGCGGGCTGGTCACGGCGGCGCGGGTGGTGGGCCA
TGAAGGGCGTTCTGTTACCTATGAGCTGCGTATGGAGCCGTGGGTAAAACTGCTGACCCACACCAGCGAC
TACAAGGCATTCCAGAATAAAACCGTGGTGGACATTCTCGATGAAGTGCTGGCTGAGTATCCGTATCCGG
TGGAAAAGCGACTGGTGGAAAGCTACCCGGTACGCACCTGGCAGGTACAGTACGGTGAAACTGATTTTGA
TTTTCTTCAGCGACTGATGCAGGAGTGGGGCATCTACTGGTGGTTTGAGCACAGCGAGGACAGCCACACG
CTGGTGCTGGCGGATGCCATCAGTACACATCACGCCTGCCCGGATTCACCGGAGGTAGAATGGCATCAAA
AAGGGTTAAAGCTGGATAAAGCATTTATCCACACCATTATAGCCAATGAAAGTCTGCGTACCGGGCAGTG
GGTACTGGATGATTTTGACTTTAAAAAACCGCGCTCGCGGCTGGCGAACACAGTGGCAAACCCGCGTGAA
ACCGGCCATGCCAGTTACGAACACTACGAATGGCCGGGCGATTATTTCGACAAGGGCGAAGGCGAAATGC
TGACGCGCATTCGTATGGAAGCGCAGCGCAGCCCTGGCAGCCGGGTTCACGGTGCCGGGAATATCCGTAC
GCTGATGACTGGCTACACCTTTGCGTTGATGAATCACCCTACGGCAGAACTCAACCAGGAATATCTGTTG
GCGCAGACTACGCTGTTTGTGCAGGACAACGCGCAGCACAGCGGGCAGGACCAGCACTTTACCTTTTCCA
CCCGTTTTGAACTGCACCCGACCCGTGAGGTGTTCCGCCCGCAGCGGACGGTGAGCAAACCCCACACCAA
AGGGCCGCAGAGCGCCATCGTCACCGGCCCGGCGGGCCAGGAAATCTGGACGGATCAGTACGGGCGGGTA
AAGGTGCAGTTTGGCTGGGACCGTTACGGCAAAATGGATGAAAACAGCTCCTGCTGGATACGCGTCAGCT
ACCCATGGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGTGCTGGTGGATTT
CAAAAACGGCGATCCGGATCTGCCGATCATCGTGGGGCGTACCTACAACCAGGACACCATGCCGCCGTGG
GGACTGCCGGGAATGGCGTCGCAGAGCGGGATCTTCAGCCACTCGCTGTATGGCGGGCCAACGAACGGCA
ACATGCTGCGTTTTGACGACAAAACCGGCGCGGAGGAAGTGAAGTTCCACGCGGAAAAAGATCTCAACAC
CACGGTGAAGAATAATGAAACGCATACGGTTATGGTGGATCGCACTAAAACCATTATTAAAAATGAAACC
AACAGTATTGGTGAGGACAGAAACACCACGGTAACGAAGAATGACGGCCTTTCCGTAAAACTGGCGCAGA
CGATCAATATCGGCACCACTTATCGTTTAGATGTTGGCGATCAATTCACGCTTCGCTGCGGCAATGCGGC
GCTTGTTTTACATAAGGACGGCTCCATTGAGTTTTGTGGCAAGCAACTGATGTTACATACCAGCGATGTC
ATGCAACTGATTGGTAAAGGTATTGATATGAACCCGGATGGCGGCACAGCCGTAACCGCCGATGATATTG
CCCCCCTTCCCACCTCTGAATGA