SecReT6
Protein ID: 194736056
SecReT6 ID295
T6SS typei3
Gene symbol-
Locus tagSeSA_A0312
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconchromosome [GenBank: NC_011094] [Browse all T6SS(s) in this replicon]
Location [Strand]321627..322118 [+]
Producttype VI secretion lipoprotein, family protein
NoteTssJ
UniProt IDB4TYI8
KEGG IDsew:SeSA_A0312
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-41, Aligned region: 5..156
Protein Sequence: 163 a.a.     [Download]
>gi|194736056|ref|YP_002113298.1| type VI secretion lipoprotein, family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKNDAAFTTADYWSLHDN
DKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSNFIP
GKGKVQLDAELEQSAIVITERDK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|194733902|ref|NC_011094.1|:321627-322118 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 chromosome, complete genome
ATGCCTTTTGCACTGCTCCTGCTTTCCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGC
GACTCGACCTGAGCGTGAAAGCCTCTGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGA
GATACGTGTTTATGAACTAAAAAATGACGCCGCTTTCACGACAGCCGATTACTGGTCGCTCCATGACAAC
GACAAATCCGTCCTTACCGACGATTTAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAA
AACTGCGTCGCCCGCTGAATGCGCAGACCACGGCAATCGGCGTACTGGCCGGATATCGTAACCTGGCCAA
ATCGGTCTGGCGGGTAACCTACAAAATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAACTTTATACCG
GGGAAAGGAAAAGTGCAGTTGGATGCGGAACTGGAACAAAGCGCTATTGTAATTACGGAACGGGATAAAT
GA