SecReT6
Protein ID: 194736246
SecReT6 ID295
T6SS typei3
Gene symbol-
Locus tagSeSA_A0297
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconchromosome [GenBank: NC_011094] [Browse all T6SS(s) in this replicon]
Location [Strand]307730..308725 [-]
Producttype VI secretion protein, family protein
NoteTssG
UniProt IDB4TYH3
KEGG IDsew:SeSA_A0297
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.20E-92, Aligned region: 10..310
Protein Sequence: 331 a.a.     [Download]
>gi|194736246|ref|YP_002113283.1| type VI secretion protein, family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MTGALDQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFRLGQTPTMTFAPREIAQVSWLDGRLH
LSLYSLGLWGPNGPLPLHYTELALNRSESRHDPTLVHFSNIFHHRWLTQFWQAWRSGQSAGGGLDKPEHD
RFAFYIASLSGQDLRESAESPLSDHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVAN
DEITRLGTPAQSSVLGNGALIGQAVPDMQYKFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEHC
WEIELQLKPHAAPPAVIGGAQQLGWTAWAGKAMHDRPVTGMIFEPEHGLTH
 
Nucleotide Sequence: 996 bp     [Download]
>gi|194733902|ref|NC_011094.1|:c308725-307730 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 chromosome, complete genome
ATGACCGGCGCTCTCGACCAGGCGCAGAAAACCCCATGGCGTTACGGATTCCTGAACCTGATGCGGCGCG
TGGATGCCCAGCTCTGTGATACTCCGGCAGGCAGTATCTGGCAGCCACGGATGGAAAAATTCCGTCTGGG
ACAGACGCCGACGATGACCTTTGCGCCACGGGAAATCGCCCAGGTCAGCTGGCTGGATGGACGCCTGCAC
CTGAGCCTGTACAGCCTCGGACTGTGGGGGCCAAACGGCCCGTTGCCGCTGCACTATACCGAGCTGGCGC
TAAATCGCTCAGAGAGCCGTCACGATCCGACGCTGGTTCATTTTTCCAATATTTTTCACCACCGCTGGCT
GACGCAGTTCTGGCAGGCATGGCGCAGCGGCCAGTCCGCTGGTGGCGGGCTGGACAAACCGGAACACGAC
CGTTTTGCGTTTTATATCGCCAGTCTCAGCGGGCAGGATCTACGGGAAAGCGCCGAAAGCCCGCTGTCAG
ATCATGTTCGCCTGGCAGCCTCCGCTCATCTGGTACGCGAATCGCGCAATCCTGACGGGCTGGCCGCCAC
GCTGGCGCACTATTTCAGCGTACCTTTTGCGGTGAAAGAGTTCGCCCTGCACTGGATAACGGTGGCGAAC
GATGAAATCACCCGTCTGGGCACGCCCGCGCAGTCTTCGGTGCTGGGCAACGGGGCGCTTATCGGCCAGG
CCGTACCGGATATGCAGTACAAATTCCGGCTAATTATCGGCCCGCTCACGCTGGAGGATTACCTGCGTTT
TCTGCCCGGCGGCAACAATTTGCCCGTGCTGACAGAACTGGTGCGTACGTTCATCGGTTTTGAACATTGC
TGGGAGATTGAACTGCAGTTAAAGCCTCATGCCGCACCGCCTGCGGTGATCGGCGGCGCGCAGCAGCTTG
GCTGGACGGCCTGGGCAGGTAAAGCCATGCATGACCGTCCGGTGACCGGCATGATTTTTGAACCTGAACA
CGGCTTAACCCACTGA