SecReT6
Protein ID: 194736479
SecReT6 ID295
T6SS typei3
Gene symbol-
Locus tagSeSA_A0314
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconchromosome [GenBank: NC_011094] [Browse all T6SS(s) in this replicon]
Location [Strand]323462..324766 [+]
Producthypothetical protein
NoteTssL
UniProt IDB4TYJ0
KEGG IDsew:SeSA_A0314
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.00E-61, Aligned region: 62..266
OmpA [PF00691], Evalue: 4.90E-16, Aligned region: 193..211
OmpA [PF00691], Evalue: 4.90E-16, Aligned region: 328..426
Protein Sequence: 434 a.a.     [Download]
>gi|194736479|ref|YP_002113300.1| hypothetical protein SeSA_A0314 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MTDSTLTPPAADMMSFLSTTPEHKDSEYETPVHTSQRTELNVIVEDGPDSKLRLAEISAAANPLLAAARP
LLCALAAMPAKLDAALVEPYRNLLVREMHLYQTLCDQANLRREHVLAVRYCLCTALDEAANNTTWGRRGV
WAGKSLLVTFHGESEGGIKLFQIIGRLAASFQEHGNVLEVIYHLLGLGFEGRYSVQPDGRKQLDNIRQQL
LTQLSQRRDPVMPALSPDFQGAISGRLRRMRRVPVWLSAGIALLAMLTLFGLYSHRMDVQTVTVQQHIDA
IGIKLPPPPVPVHKLRLKILLANEIARGLLTVDEDDQHSRVVFRGDAMFVPGQKTVSDAIRPVINKAARE
IARVGGAVTVTGHTDSQPIHSAEFPSNLVLSEKRAAEVAALLTSGGVPAGRVHIVGKGDTVPVADNGSKA
GRAKNRRVEILVVE
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|194733902|ref|NC_011094.1|:323462-324766 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 chromosome, complete genome
ATGACAGACAGTACCCTGACGCCGCCAGCGGCGGACATGATGTCCTTTTTGTCCACCACGCCGGAACATA
AGGACAGTGAATATGAAACGCCGGTACACACCAGCCAGCGCACGGAACTCAATGTCATCGTTGAAGACGG
TCCGGACAGCAAACTCCGGCTGGCTGAAATCAGCGCGGCGGCTAACCCGTTGCTCGCCGCTGCCCGGCCT
TTATTGTGCGCTCTCGCAGCCATGCCCGCTAAACTGGATGCGGCCCTGGTAGAGCCTTACCGTAATCTGC
TGGTACGCGAGATGCATCTGTACCAGACATTATGCGATCAGGCGAACCTGCGGCGCGAGCACGTACTGGC
GGTACGTTACTGCCTGTGTACGGCGCTTGATGAAGCCGCCAATAACACAACCTGGGGACGGCGCGGCGTC
TGGGCCGGAAAAAGCCTGCTGGTAACATTTCATGGTGAAAGCGAAGGCGGGATAAAACTTTTCCAGATCA
TCGGGCGTCTGGCGGCCAGCTTCCAGGAACATGGCAACGTACTGGAGGTTATCTACCACCTGCTGGGGCT
GGGATTTGAAGGCCGCTACAGCGTGCAGCCAGACGGGCGTAAGCAACTGGACAATATTCGTCAGCAACTG
CTGACACAGCTTTCACAGCGTCGCGATCCGGTCATGCCCGCGCTCTCGCCTGACTTTCAGGGGGCGATAA
GCGGACGACTGCGGCGGATGCGCCGGGTGCCGGTCTGGCTGAGCGCCGGGATAGCCCTGTTGGCGATGCT
GACGCTGTTTGGCCTTTACAGCCACCGGATGGATGTGCAGACCGTCACCGTACAACAGCATATTGATGCG
ATTGGTATAAAACTGCCGCCGCCGCCCGTGCCGGTTCATAAGCTGCGGCTGAAAATCCTGCTGGCAAACG
AAATCGCCCGTGGCCTGCTGACCGTGGACGAAGATGACCAGCACAGTAGGGTGGTCTTCCGTGGCGACGC
CATGTTTGTACCGGGACAAAAAACGGTGAGTGACGCAATCCGGCCAGTGATTAACAAAGCGGCGCGGGAA
ATCGCCCGCGTGGGCGGCGCAGTCACTGTAACGGGTCACACTGACAGCCAGCCCATTCATTCGGCTGAAT
TCCCATCCAACCTGGTGCTGTCGGAAAAACGGGCGGCGGAAGTTGCGGCGTTGCTGACCTCCGGCGGCGT
ACCTGCCGGACGGGTACATATCGTCGGCAAGGGCGATACGGTGCCGGTGGCGGATAACGGCAGTAAAGCC
GGGCGGGCGAAAAACCGTCGGGTGGAAATTCTGGTAGTGGAGTGA