SecReT6
Protein ID: 194736484
SecReT6 ID295
T6SS typei3
Gene symbol-
Locus tagSeSA_A0296
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconchromosome [GenBank: NC_011094] [Browse all T6SS(s) in this replicon]
Location [Strand]306670..307713 [-]
ProductImpA-related N- family protein
NoteTssA
UniProt IDB4TYH2
KEGG IDsew:SeSA_A0296
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-18, Aligned region: 49..108
ImpA-rel_N [PF06812], Evalue: 1.50E-18, Aligned region: 222..239
Protein Sequence: 347 a.a.     [Download]
>gi|194736484|ref|YP_002113282.1| ImpA-related N- family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIRVL
ILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAESIEDAALVRSNALAALLDHEGVM
ADIRGITLSNSAALRLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQVW
ARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPDPAGTVMVNAVPARAEDVPPVNTPPGISLPH
NAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDALE
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|194733902|ref|NC_011094.1|:c307713-306670 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 chromosome, complete genome
ATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACGATCCGGAGTACC
TGCTGCTGTTCAGCCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCCGGAAGC
CGTGAACTGGCCGGAAATTGAGCGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGGGTGTTG
ATCCTGCTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATGCTCACACAACTGG
CAGAACTGAGCGTAATCTGGTCTGATGCACTCCATCCACAGCTGCTTACCGGCGAAGGCGCATCCGCAGA
ATCTATTGAAGATGCGGCGCTGGTGCGCAGTAATGCCCTGGCGGCGCTGCTGGATCACGAAGGCGTGATG
GCAGACATTCGCGGTATCACGCTGTCAAACAGTGCCGCCCTGCGCCTGCAGGTACGGGATGTCGAGCGCG
CGTTATCCGCTCCCCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCCGACCTCGA
AGCCCGTGGGGCATTACCGCTGGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAAGTGTGG
GCGCGTGAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTGGCGCTGCTGCCTG
ACGTGGTACAGACAACCACGCCGGAAATCCCTCCGTCGCCAGCGCCAGACCCCGCAGGCACGGTTATGGT
TAATGCCGTTCCGGCACGGGCAGAGGATGTGCCGCCTGTCAACACGCCCCCCGGTATATCCCTCCCACAC
AATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAACGCCTGCGGTGCATTCGTCGCTGGT
TTGAGAGCAGTGAACCCAGCAGCCCGACCATCCCACTGTTACGCCAGGCTGAAAGACTGGTGGGAAAACG
GTTCTCGGAGGTGATCAATGAAATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTGGAATGA