SecReT6
Protein ID: 194736842
SecReT6 ID295
T6SS typei3
Gene symbolvasA
Locus tagSeSA_A0298
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconchromosome [GenBank: NC_011094] [Browse all T6SS(s) in this replicon]
Location [Strand]308722..310605 [-]
Producttype VI secretion protein, family protein
NoteTssF
UniProt IDB4TYH4
KEGG IDsew:SeSA_A0298
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-210, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|194736842|ref|YP_002113284.1| type VI secretion protein, family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPYVERMIEAFSFLSARTQLKIDAEFPR
FTQRLLEVVSPNYVTPTPSMAVVKLYPDTQEGDLAKGVTVPRDTAFVSPIPEGENTACQFRSSQDVTLWP
LSIEEVRLTAAPPDMPALHRYLPPNIHVAGALRITLRTFGELTFSELAGPARLPFYLCGEERIASHLFEL
LHTSAVATLAGEPGHFDGELNVNLQHPVAHEGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTG
LSAGLQKVQGNVAEIVILLNRLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRIEVTHSVTEQHLVVDRT
RPLDYEVFSVQEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRREPRRSSENARRYGTRTPYTGSE
IFLSLVDQHEAPYPENLRHITVTAMVTNRDLPCLIPRNGRDDLTVDAAIPVAGVGLIRPPRPPQPPLAER
EMAWRLIRQLSFNYLPLADLDHRTGGQALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLV
YGRGVSCELTVDEEGFSGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGHVMTWPVRTGQRGSV
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|194733902|ref|NC_011094.1|:c310605-308722 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 chromosome, complete genome
ATGGATCCACGGCTACTGGAGTATTACAACCGCGAACTGAGCTACCTGCGGGAGACTGGTGCTGAGTTCG
CCACCCTCCATCCCAAAATTGCCGCCCGACTGGGGATGCAGGGAACCGATATTGCCGACCCGTATGTGGA
ACGCATGATCGAGGCGTTCAGCTTTCTGAGCGCCCGTACTCAGCTAAAAATTGACGCCGAGTTTCCCCGC
TTCACACAGCGGTTACTGGAAGTCGTCAGCCCCAATTACGTCACCCCCACGCCATCGATGGCAGTGGTAA
AGCTGTATCCCGATACGCAGGAAGGCGACCTGGCGAAAGGGGTCACCGTGCCGCGCGATACCGCGTTCGT
TTCCCCTATCCCGGAAGGCGAAAATACCGCCTGCCAGTTTCGCAGCAGCCAGGACGTCACGCTGTGGCCG
CTGTCCATCGAGGAGGTACGCCTGACCGCCGCGCCACCGGATATGCCCGCCCTGCACCGCTATCTGCCGC
CTAATATTCATGTCGCCGGGGCATTGCGCATCACCCTGCGAACCTTCGGGGAACTGACTTTCAGCGAGCT
GGCCGGTCCGGCACGGCTGCCCTTTTACCTCTGCGGCGAAGAACGCATTGCGTCACACCTGTTTGAGCTG
CTGCATACCAGCGCCGTCGCCACACTGGCCGGTGAACCCGGTCACTTTGACGGCGAACTGAATGTGAATC
TTCAACACCCGGTGGCGCACGAAGGGCTGGAGCCAGGGCAGGGGCTGCTGCCGCTCGCCTGGAACGTGTT
TCACGGCCATAATCTGCTGCATGAATTTTTCGCCTGTCCGGAACGGTTTTACTTCTTCACCCCGACCGGA
TTGTCTGCCGGGTTACAAAAGGTGCAGGGCAATGTGGCGGAAATTGTCATACTGCTTAATCGCCTGCCGC
CGGACTGGCTGATTCATCAGACGGACGCTGCACAGTTCAGCCTGTTCTGTACGCCGGTGATCAACCTGTT
TCCCCGCACCACCACCCGGATTGAAGTCACTCACAGCGTGACGGAACAGCATCTGGTGGTAGATCGTACC
CGTCCGCTGGATTACGAGGTGTTTTCTGTTCAGGAAGTCGAAGGCCTGGAAGCGGAAACCACACGGAAGA
TGATTTTTCGTCCGCTGTATCACACCCGTAATAATGACGAAGGCAACCACGGGCGTTATTTTTCACTGCG
TCGTGAACCGCGCCGCTCGTCAGAAAATGCCCGCCGCTATGGCACCCGAACCCCCTATACCGGCTCGGAA
ATCTTCCTGTCGCTGGTTGATCAGCATGAAGCGCCCTACCCGGAAAATCTGCGCCATATCACCGTCACGG
CAATGGTGACTAACCGCGATCTGCCCTGTCTTATTCCACGTAATGGCCGGGATGATCTGACCGTAGATGC
GGCGATCCCGGTGGCGGGCGTGGGTCTTATCAGACCGCCGCGCCCGCCGCAGCCGCCGCTGGCTGAACGC
GAAATGGCCTGGCGGCTGATCCGGCAGTTGTCGTTTAATTATCTGCCGCTGGCCGATCTGGATCACCGCA
CCGGCGGCCAGGCGCTGCGCGATCTGCTGAATCTGTTTATTCCGGCTCACGACAGCCCGCAGTCGCGCCA
GGTGCGCAGCCTGATTGGCTGCAAAACCACCCCAGTAACCCGCCGCCTGCCCGGCTCCGGTCTGTTGGTC
TATGGCCGGGGCGTCAGTTGCGAACTGACCGTGGACGAAGAAGGATTTTCCGGTATCAGTCCTTACCTGT
TCGGTCTGGTGCTGGAACACTATATTGCCCGCCATGTTTCCATTAATACCTTCTCACAGATGACGCTGCA
CTCGATGCAACGCGGGCATGTCATGACCTGGCCGGTAAGAACCGGGCAACGGGGGAGCGTATGA