SecReT6
Protein ID: 194737470
SecReT6 ID295
T6SS typei3
Gene symbol-
Locus tagSeSA_A0299
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconchromosome [GenBank: NC_011094] [Browse all T6SS(s) in this replicon]
Location [Strand]310621..311115 [-]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDB4TYH5
KEGG IDsew:SeSA_A0299
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.60E-22, Aligned region: 35..147
Protein Sequence: 164 a.a.     [Download]
>gi|194737470|ref|YP_002113285.1| type VI secretion system lysozyme-related protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRGISVTPVQLKEIIRRDLSFLLNTISHEGDIDARRYPQAA
ASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLLDKTRQGSYNTLQFEIRGQIL
TQPYPTEFLVRSALDMELSRITFF
 
Nucleotide Sequence: 495 bp     [Download]
>gi|194733902|ref|NC_011094.1|:c311115-310621 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 chromosome, complete genome
ATGAGCACGTCTCGTTTTACACCCGCTAACCACCTGCTGCCCACCCTATTTGATCGGCTGTGTGACAATG
CTCCGTATCAGAAAATTGACCGGGGTATCAGCGTCACGCCGGTACAACTGAAGGAGATCATTCGTCGGGA
TCTCTCCTTTTTGCTCAATACCATTAGCCACGAAGGTGACATCGACGCCCGGCGCTATCCGCAGGCGGCG
GCGTCAGTGCTCAACTATGGCCTGCCGCCGCTGGCGGGCAGCTTTATGTATGAGCATAAGTGGGACGATA
TCAGCGAGGCGATCCGGCGCGCCATTATCCGTTTCGAACCCCGGCTGAACGCCGCCACACTCAGGGTCAC
GCCCTTGCTCGATAAAACCCGGCAGGGTAGCTATAACACGCTACAGTTTGAAATTCGCGGACAAATTCTG
ACGCAGCCGTATCCCACGGAGTTTCTGGTACGCAGCGCGCTGGATATGGAGCTGAGCCGCATTACGTTCT
TTTAA