SecReT6
Protein ID: 197119409
SecReT6 ID296
T6SS typei4a
Gene symbol-
Locus tagGbem_3038
StrainGeobacter bemidjiensis Bem
Repliconchromosome [GenBank: NC_011146] [Browse all T6SS(s) in this replicon]
Location [Strand]3504210..3505241 [-]
Producttype VI secretion system protein
NoteTssG
UniProt IDB5E871
KEGG IDgbm:Gbem_3038
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.90E-84, Aligned region: 19..321
Protein Sequence: 343 a.a.     [Download]
>gi|197119409|ref|YP_002139836.1| type VI secretion system protein [Geobacter bemidjiensis Bem]
MHSAGTEECPKIRKRLLLEFHRYSFFQAVNYLERSRLEGRDLGQALSPKEEPVRFRARTGFSFPASDIAN
LEEGRDGAPPQMEVAFMGVVGPSGTLPNWYHELALERGRAKDPAMIAFYDLFHHRLISLFYLVWKRSRVM
PGKKSDHSDRFSNYLLNIIGLGTPGLAGVCSPGGVPLFFCGQISRNIPTAGMVAAVVQYQLGLAAEVEQF
VPRLITLEPEDRTIIGEGNCELGKNASCGGEVWESQTTFRLCLGPMSLREFNDMLPGGGRLTSLVAFVRY
LVGVEYEFEVRLVLKKEEVPTLMLGEAGPDAPRLGWSMWMKAPGTTLSDDPYVTLREVYATSH
 
Nucleotide Sequence: 1032 bp     [Download]
>ref|NC_011146.1|:c3505241-3504210 type VI secretion system protein [Geobacter bemidjiensis Bem]
ATGCATTCAGCCGGGACCGAAGAGTGTCCAAAAATAAGAAAGCGCCTGTTGCTGGAGTTTCACCGCTACT
CCTTTTTCCAGGCGGTGAATTATCTGGAACGAAGCCGGTTGGAGGGGCGCGATCTCGGGCAGGCCTTGAG
TCCGAAAGAGGAGCCGGTCCGCTTCCGCGCCCGCACCGGCTTTTCGTTTCCCGCCAGCGACATAGCGAAC
CTGGAGGAGGGAAGGGACGGAGCTCCCCCGCAGATGGAAGTGGCGTTTATGGGAGTGGTCGGGCCGTCGG
GAACGCTTCCTAACTGGTACCACGAACTGGCGCTGGAGCGGGGTCGGGCGAAGGACCCGGCGATGATAGC
CTTTTACGATCTCTTCCATCACCGGCTCATCTCGCTGTTTTACCTTGTCTGGAAGCGAAGTCGTGTCATG
CCTGGCAAGAAGAGTGACCATTCGGACCGCTTTTCCAACTATCTCCTCAACATCATCGGGCTGGGAACAC
CGGGACTAGCCGGGGTCTGCTCTCCTGGGGGGGTACCGCTTTTTTTCTGTGGACAGATCTCCCGAAACAT
CCCCACCGCTGGAATGGTAGCTGCGGTGGTGCAGTACCAGCTAGGCCTGGCGGCGGAAGTGGAGCAGTTC
GTCCCCAGGCTGATCACTTTGGAGCCGGAGGACAGGACGATCATTGGAGAAGGCAATTGCGAGCTTGGTA
AAAATGCGAGCTGCGGCGGCGAAGTATGGGAGAGCCAGACAACCTTCCGCCTCTGTCTCGGTCCCATGTC
GCTTCGAGAGTTCAACGACATGCTCCCCGGGGGGGGAAGGCTAACCTCGTTAGTCGCGTTTGTCAGGTAT
CTGGTAGGCGTGGAGTACGAGTTCGAGGTGCGGCTGGTTTTAAAGAAGGAAGAAGTCCCAACGTTGATGC
TGGGAGAAGCAGGACCGGATGCGCCAAGGCTTGGCTGGTCCATGTGGATGAAGGCGCCGGGGACGACGCT
GTCTGACGATCCTTACGTGACACTGCGGGAAGTCTATGCAACCAGCCACTGA