SecReT6
Protein ID: 197119411
SecReT6 ID296
T6SS typei4a
Gene symbol-
Locus tagGbem_3040
StrainGeobacter bemidjiensis Bem
Repliconchromosome [GenBank: NC_011146] [Browse all T6SS(s) in this replicon]
Location [Strand]3507036..3507515 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB5E873
KEGG IDgbm:Gbem_3040
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.40E-19, Aligned region: 40..141
Protein Sequence: 159 a.a.     [Download]
>gi|197119411|ref|YP_002139838.1| type VI secretion system lysozyme-like protein [Geobacter bemidjiensis Bem]
MTARRGNTPYLKRSLLDRLIAAPARSGPVQAGAGVLGDILDSLLRDLENLLNTRRSVPLAPDCRQESQKS
VLSYGTRDFSTHNPRTALAREQIRLEIQRLLLSFEPRLKEAVVRLDVLPESDRTLQFRIEGVLMVEPQPA
PVSFATSFDSNSGAYSVFK
 
Nucleotide Sequence: 480 bp     [Download]
>ref|NC_011146.1|:c3507515-3507036 type VI secretion system lysozyme-like protein [Geobacter bemidjiensis Bem]
GTGACAGCTCGCAGGGGAAATACCCCCTACCTGAAAAGATCGTTGCTGGACAGGCTCATTGCTGCTCCGG
CACGCAGTGGGCCTGTCCAGGCCGGGGCGGGAGTCTTGGGTGACATCCTGGACTCCCTGCTTCGCGACCT
GGAAAACCTTCTCAACACGAGGAGAAGTGTCCCGCTCGCGCCGGACTGCAGGCAAGAGTCGCAGAAGTCC
GTTCTCAGCTACGGCACAAGGGATTTCAGCACGCACAACCCACGCACGGCCTTGGCCAGAGAGCAGATCC
GGCTGGAGATACAGAGGTTGCTGCTGTCGTTCGAACCTCGTCTTAAAGAGGCAGTGGTTCGGCTCGATGT
CCTCCCAGAATCGGACCGGACCCTGCAGTTCAGGATCGAGGGGGTCTTGATGGTCGAGCCGCAGCCGGCT
CCGGTTAGCTTTGCTACTAGCTTCGACAGCAACAGCGGCGCCTACTCCGTCTTCAAGTGA