SecReT6
Protein ID: 197119413
SecReT6 ID296
T6SS typei4a
Gene symbol-
Locus tagGbem_3042
StrainGeobacter bemidjiensis Bem
Repliconchromosome [GenBank: NC_011146] [Browse all T6SS(s) in this replicon]
Location [Strand]3508028..3509515 [-]
Producttype VI secretion system protein
NoteTssC
UniProt IDB5E875
KEGG IDgbm:Gbem_3042
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.20E-192, Aligned region: 67..490
Protein Sequence: 495 a.a.     [Download]
>gi|197119413|ref|YP_002139840.1| type VI secretion system protein [Geobacter bemidjiensis Bem]
MGEQDREPEVLYAEPLPAGGLLELIIQEGRLARGVCRREHAVDLVGELAQQVLEGGMTVSRDTEQMINQR
IAQLDALISAQVNEIIHHPEFQRLEASWRGLDHLVHQSETGANLKIRVLNVSRRDLVQDMEKAAEFDQSA
LFKKVYEEEFGSYGGASYGCLVGDFEFGNTPQDLSLLTRISEVAAAAHAPLLTAASPSLFNMETFGELDR
PRDLAKIFQGPEYAKWKSFRISEDARYVALCLPRVLMRLPYGPDADPAELFQFNEDVDGTEHGNYLWGNA
AYCLAERVTEAFAKYGWTAAIRGVEGGGLVSDLPVHCFKTGEGEVAHKCPAEIAITDRREKELADLGFIP
LVHCKGTDNAAFFSAQSAHRPKSYDSDAANANARLSAQLQYILAVSRFAHYLKALMRDKVGSFDTRKNVE
DYLNRWISNYVLLDDDAGQEMKSRYPLREARVEVFEDPAKPGAYRAVAFLKPHFQLDELTVSLRLVASLP
APARE
 
Nucleotide Sequence: 1488 bp     [Download]
>ref|NC_011146.1|:c3509515-3508028 type VI secretion system protein [Geobacter bemidjiensis Bem]
ATGGGAGAGCAAGATAGGGAACCGGAAGTACTGTACGCGGAGCCGCTACCTGCGGGAGGCCTGCTGGAGC
TGATAATCCAGGAAGGGCGACTTGCCCGCGGCGTCTGTCGCCGTGAGCATGCAGTGGACCTTGTGGGCGA
ACTGGCGCAGCAGGTCCTTGAGGGGGGGATGACGGTGAGCCGCGACACGGAACAGATGATCAACCAGAGG
ATCGCCCAACTGGACGCGCTCATCTCCGCGCAGGTTAACGAGATCATCCACCATCCCGAATTCCAGAGGT
TGGAAGCCTCCTGGCGCGGCCTTGACCATCTCGTGCACCAAAGCGAGACTGGAGCCAACCTGAAGATCAG
GGTTCTGAACGTCTCGCGCCGGGACCTAGTGCAGGACATGGAGAAAGCGGCAGAGTTCGATCAGTCCGCC
CTGTTCAAGAAGGTGTACGAGGAGGAGTTCGGCAGCTACGGCGGGGCTTCCTACGGTTGCCTGGTGGGTG
ACTTCGAATTCGGCAACACGCCGCAGGATCTTTCGCTTTTGACACGGATATCCGAGGTCGCGGCTGCCGC
GCACGCACCGTTATTGACCGCAGCGTCTCCTTCCCTGTTCAACATGGAGACCTTCGGCGAACTCGACCGG
CCCAGGGACTTGGCCAAGATCTTTCAAGGGCCGGAATACGCCAAGTGGAAATCCTTCCGCATCTCGGAGG
ACGCCCGTTACGTGGCCCTTTGCCTCCCCCGGGTGCTGATGCGGCTCCCCTACGGACCCGACGCCGATCC
GGCTGAACTATTCCAGTTCAATGAGGATGTGGACGGCACCGAACACGGCAATTATCTCTGGGGCAATGCA
GCCTATTGTCTGGCCGAACGGGTGACCGAAGCTTTCGCGAAATACGGCTGGACCGCGGCGATCAGGGGAG
TGGAAGGTGGCGGTCTTGTGAGCGACCTGCCGGTGCACTGCTTCAAAACGGGGGAAGGGGAAGTAGCCCA
CAAGTGCCCGGCTGAGATTGCCATCACCGACCGGCGCGAAAAGGAGCTGGCGGACCTGGGCTTCATCCCG
CTGGTCCATTGCAAAGGGACCGACAACGCCGCGTTCTTCAGCGCCCAAAGCGCACACCGTCCCAAGAGCT
ACGACTCCGATGCGGCCAACGCGAACGCAAGGCTCTCGGCGCAGTTGCAGTACATTCTCGCCGTCTCGCG
ATTCGCGCATTACCTGAAGGCGCTGATGCGCGACAAGGTCGGCAGCTTCGACACCAGGAAGAACGTGGAG
GACTACCTCAACCGCTGGATCAGCAACTACGTGCTTCTGGACGACGACGCCGGCCAGGAGATGAAATCGC
GCTACCCACTGCGGGAGGCCCGGGTGGAGGTTTTCGAAGATCCCGCCAAGCCCGGTGCCTACCGCGCCGT
CGCTTTTTTGAAGCCGCACTTCCAGCTTGACGAACTTACCGTCTCGCTGAGGCTTGTGGCCAGCCTGCCG
GCACCGGCAAGAGAATAA