SecReT6
Protein ID: 197119414
SecReT6 ID296
T6SS typei4a
Gene symbol-
Locus tagGbem_3043
StrainGeobacter bemidjiensis Bem
Repliconchromosome [GenBank: NC_011146] [Browse all T6SS(s) in this replicon]
Location [Strand]3509527..3510057 [-]
Producttype VI secretion system protein
NoteTssB
UniProt IDB5E876
KEGG IDgbm:Gbem_3043
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.50E-55, Aligned region: 11..165
Protein Sequence: 176 a.a.     [Download]
>gi|197119414|ref|YP_002139841.1| type VI secretion system protein [Geobacter bemidjiensis Bem]
MAKSESLQHKLERVRAPRVRITYDVETGGGIEMKEIPFVVGVLADLSGKRDQPLPRLKERSFVEVDRDNI
DSVLEGMRPRAAFRVPNRLVEDGSQLAVDLSFTTLDDFHPEKVALQVEPLRRLVEARKRLSDLLARLDGN
DRLEQLLQEALSSPDALKLICEEAKCAKEPDTESAG
 
Nucleotide Sequence: 531 bp     [Download]
>ref|NC_011146.1|:c3510057-3509527 type VI secretion system protein [Geobacter bemidjiensis Bem]
ATGGCAAAGTCCGAGAGCCTGCAACACAAGTTGGAACGCGTGCGGGCGCCCCGTGTCCGCATCACCTACG
ACGTGGAGACCGGGGGCGGCATCGAGATGAAGGAGATTCCTTTCGTGGTGGGGGTGCTTGCCGACCTGTC
GGGGAAGCGGGATCAACCCCTGCCGAGGCTGAAGGAGAGGAGCTTCGTGGAAGTCGACCGCGACAACATC
GATTCGGTCCTGGAGGGGATGCGGCCGAGAGCGGCATTCCGGGTTCCGAACCGGCTGGTGGAAGACGGCT
CCCAACTCGCCGTCGACCTTAGTTTCACAACTCTCGATGACTTTCATCCAGAGAAGGTGGCCCTGCAGGT
GGAGCCGCTCCGAAGACTGGTCGAGGCGCGGAAGAGGCTCTCGGATCTGCTTGCGAGGCTCGACGGCAAC
GACCGGCTCGAACAGTTGCTGCAGGAGGCGCTGTCCAGCCCGGATGCGCTGAAACTCATCTGTGAGGAGG
CGAAGTGCGCCAAGGAACCAGACACTGAGAGCGCCGGATAA