SecReT6
Protein ID: 197119415
SecReT6 ID296
T6SS typei4a
Gene symbol-
Locus tagGbem_3044
StrainGeobacter bemidjiensis Bem
Repliconchromosome [GenBank: NC_011146] [Browse all T6SS(s) in this replicon]
Location [Strand]3510082..3511401 [-]
Producttype VI secretion system ImpA-like domain-containing protein
NoteTssA
UniProt IDB5E877
KEGG IDgbm:Gbem_3044
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.60E-21, Aligned region: 55..114
ImpA-rel_N [PF06812], Evalue: 1.60E-21, Aligned region: 318..326
TPR_4 [PF07721], Evalue: 0.0048, Aligned region: 317..337
TPR_4 [PF07721], Evalue: 0.0048, Aligned region: 354..376
Protein Sequence: 439 a.a.     [Download]
>gi|197119415|ref|YP_002139842.1| type VI secretion system ImpA-like domain-containing protein [Geobacter bemidjiensis Bem]
MQDVTVDELLAPISTEAPAGSDLRYTTFYEEIMEARRSDDAVALGDWRHDVKAADWNKVIKLCVAALSTK
SKDLQIAVWLCESLIVVDGFPGLDAGLRLLKELMGRYWDCFYPVSGDEDLEYRAAPLDFLNEKVATQLKR
IPLTDPLVTPGYSCLKWEESRRVGYEAETRNSYGEVEEEWKQRRDARISEGGLTAEEFDAAVEKSRGTFS
EQLLESLKRCEESLQGLEWGVEAKWFPAPAPSLAALGAAMNSCQMLARKCYGVESPPQANEPEAKGSEVQ
GTEEKETAEVAPPALRQPDGIAGVSRPGAAQQQESSLWGEGLALLEAGHLEQALTMLLYTSNSCESTRDR
NRIRLLMVKLCLKAGRGDLARPIVEELHDMIEELKLERWESPVWIAEVLHAYYQCLQAGELPDEDLTLSR
VLFKRICSLDVTKGIPYRI
 
Nucleotide Sequence: 1320 bp     [Download]
>ref|NC_011146.1|:c3511401-3510082 type VI secretion system ImpA-like domain-containing protein [Geobacter bemidjiensis Bem]
ATGCAAGACGTAACAGTGGACGAACTGCTGGCCCCCATCAGCACGGAAGCGCCGGCGGGAAGCGATCTGC
GCTACACAACCTTCTACGAGGAGATAATGGAGGCCCGCAGAAGCGATGATGCCGTAGCGCTCGGGGACTG
GCGCCATGATGTAAAGGCTGCCGACTGGAACAAGGTGATCAAGCTCTGCGTCGCCGCCCTTTCCACCAAG
AGCAAAGACCTGCAGATAGCGGTCTGGCTTTGCGAGTCGCTTATCGTGGTCGACGGTTTTCCCGGTTTGG
ATGCGGGGTTGCGCCTGCTCAAGGAACTGATGGGAAGATACTGGGATTGCTTTTACCCGGTAAGCGGGGA
CGAGGACCTGGAATACCGGGCAGCTCCGTTGGACTTTCTGAACGAGAAGGTGGCCACGCAGCTAAAAAGG
ATCCCTCTCACTGACCCTTTGGTGACGCCGGGTTACTCCTGTCTCAAATGGGAGGAGTCCCGCCGTGTCG
GCTATGAGGCCGAGACCAGGAACAGTTACGGCGAAGTGGAGGAGGAATGGAAGCAGCGCCGGGATGCGCG
CATTTCGGAGGGAGGGCTCACCGCCGAGGAATTCGATGCCGCAGTGGAAAAATCTCGCGGCACCTTTTCA
GAGCAGCTTCTGGAAAGCCTCAAACGCTGCGAAGAGAGCCTGCAGGGGCTGGAATGGGGGGTCGAGGCGA
AGTGGTTCCCCGCGCCGGCACCGAGCCTGGCCGCTTTGGGGGCGGCCATGAACAGTTGCCAGATGCTGGC
AAGGAAGTGCTACGGCGTCGAATCTCCTCCCCAGGCAAATGAGCCTGAAGCAAAAGGCAGCGAAGTACAG
GGGACGGAAGAGAAGGAAACAGCAGAGGTGGCGCCGCCGGCGCTCAGGCAGCCAGACGGCATCGCCGGCG
TATCCCGTCCCGGCGCTGCGCAGCAACAGGAGAGCTCGCTTTGGGGTGAAGGGCTCGCCCTGCTGGAGGC
GGGACATCTCGAACAGGCGCTGACCATGCTGCTTTACACCAGCAACAGCTGCGAATCCACCAGAGACCGC
AACCGGATCCGCCTCCTGATGGTGAAGCTCTGCCTGAAAGCAGGAAGGGGGGATCTGGCCAGGCCGATAG
TGGAGGAGTTGCACGACATGATCGAGGAGTTGAAGCTGGAGCGTTGGGAGTCGCCGGTGTGGATCGCGGA
GGTACTGCACGCCTACTACCAGTGCCTGCAGGCGGGCGAGCTTCCGGATGAAGACCTAACCTTGTCGCGG
GTCCTGTTCAAACGGATCTGTTCCCTCGACGTCACCAAGGGGATCCCTTACCGGATCTGA