SecReT6
Protein ID: 197119417
SecReT6 ID296
T6SS typei4a
Gene symbol-
Locus tagGbem_3046
StrainGeobacter bemidjiensis Bem
Repliconchromosome [GenBank: NC_011146] [Browse all T6SS(s) in this replicon]
Location [Strand]3514829..3515488 [-]
Producttype VI secretion system protein
NoteTssL
UniProt IDB5E879
KEGG IDgbm:Gbem_3046
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.60E-46, Aligned region: 2..211
Protein Sequence: 219 a.a.     [Download]
>gi|197119417|ref|YP_002139844.1| type VI secretion system protein [Geobacter bemidjiensis Bem]
MRLIDSFMPLIAFVVDFRAACRDTPRSYQEVKGDIAQLLLQAEQACDKEAVPSDEFDLARFAVCSWVDET
LLGSDWRDKQLWQREQLQRLYYRTTEAGVELFERLQALGARGEVREVYYLCLALGFKGRYIGPGDEAKLE
HLQQENLKLLLGTPAGIPSLEQGELFPGARAPGRESAALKAPSGISPLTAMLVAAPIILFVALFLIYRYL
LNGLVLPVL
 
Nucleotide Sequence: 660 bp     [Download]
>ref|NC_011146.1|:c3515488-3514829 type VI secretion system protein [Geobacter bemidjiensis Bem]
ATGCGATTGATCGACTCTTTCATGCCGCTCATAGCTTTCGTGGTCGACTTCCGCGCCGCTTGCCGCGACA
CGCCCCGCAGTTACCAGGAGGTAAAGGGGGATATTGCGCAGTTGCTGCTGCAGGCGGAGCAGGCCTGCGA
CAAGGAAGCGGTCCCGAGCGACGAGTTCGACCTGGCCCGCTTTGCGGTCTGCTCCTGGGTCGACGAGACG
CTCTTAGGTTCCGACTGGAGGGACAAGCAGCTCTGGCAGCGGGAGCAACTGCAGCGGCTTTATTACCGCA
CCACCGAGGCGGGGGTGGAGCTCTTCGAACGGCTGCAGGCGCTGGGGGCGCGGGGCGAGGTGCGGGAAGT
CTATTACCTCTGCCTCGCCCTTGGCTTCAAGGGGCGCTATATCGGGCCAGGAGACGAGGCCAAGCTGGAA
CATCTGCAACAAGAGAACCTGAAGTTGCTGCTCGGGACCCCGGCCGGCATCCCGTCGCTGGAGCAGGGGG
AGCTTTTCCCGGGTGCCCGTGCTCCCGGCCGTGAGAGTGCGGCACTTAAGGCTCCCTCTGGAATTTCCCC
GCTGACCGCGATGCTGGTCGCAGCACCCATCATCCTGTTCGTGGCGCTGTTTCTCATTTACCGCTACCTG
TTAAACGGCCTGGTACTTCCGGTCCTCTAG