SecReT6
Protein ID: 197119418
SecReT6 ID296
T6SS typei4a
Gene symbol-
Locus tagGbem_3047
StrainGeobacter bemidjiensis Bem
Repliconchromosome [GenBank: NC_011146] [Browse all T6SS(s) in this replicon]
Location [Strand]3515509..3516903 [-]
Producttype VI secretion system protein
NoteTssK
UniProt IDB5E880
KEGG IDgbm:Gbem_3047
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.60E-81, Aligned region: 20..461
Protein Sequence: 464 a.a.     [Download]
>gi|197119418|ref|YP_002139845.1| type VI secretion system protein [Geobacter bemidjiensis Bem]
MMPIERPVFWHQGLFLRPQHFQLSERSLQSQLAPYQLCLMPDFWGVQRMEIRCTAGGIPSLEISGAFLFP
DGTYAVVPDNARVESRPVLEVALAGRDSCTVYLGLKKWSPAGHNVATLLPGDPLSKVATRFVADSDAPPR
ADLHAGGAQAEVRQMALALQLFWESELESLGDYLLIPVARLALRGETAVPSRDFIPPCITLAGSPALLDL
LQEIREQLASRCRWLEGYKKERGIQAAEFGSKDLVFLLALRTVSRHLARLSHWIEAVEVHPWQVYGLLGE
LAAELTCFSESIGAFGESVADGGRLMPQYRHQELAWSFRLARDLIVQLLNEVTAGPEYALTLAFDGTWFA
SDLKPAHFQGHSRFYLVLNTNEDPKLVLASVATAAKLTARERLPLLISQALPGIALEYIPDPPRELPHRS
TSLFFSIDSRCDQWKLVQKWNNIALSWDQAPADLEVQVMIVARS
 
Nucleotide Sequence: 1395 bp     [Download]
>ref|NC_011146.1|:c3516903-3515509 type VI secretion system protein [Geobacter bemidjiensis Bem]
ATGATGCCAATCGAGAGGCCCGTATTCTGGCACCAGGGGCTGTTTCTGCGGCCCCAGCATTTCCAGTTGT
CAGAGCGCTCGTTGCAGTCGCAACTGGCTCCGTACCAGTTGTGCCTCATGCCGGACTTTTGGGGCGTGCA
ACGGATGGAGATCAGGTGCACGGCCGGCGGGATACCTAGCCTCGAAATCTCCGGCGCCTTCCTTTTTCCC
GACGGCACCTATGCCGTCGTCCCAGATAACGCGCGGGTCGAGTCCAGGCCGGTCCTGGAAGTGGCACTGG
CGGGAAGGGATTCCTGCACCGTCTACCTTGGCCTGAAAAAGTGGAGCCCCGCCGGCCATAACGTCGCCAC
CTTGCTCCCTGGCGACCCCCTCTCCAAGGTCGCTACGCGGTTCGTTGCCGACTCAGACGCCCCGCCCCGT
GCCGATCTCCACGCAGGGGGGGCTCAGGCGGAGGTGCGGCAGATGGCCTTGGCCCTGCAGCTTTTCTGGG
AGAGCGAGTTGGAGTCGTTGGGGGATTACCTGCTCATCCCTGTCGCCCGGCTCGCGCTGCGCGGCGAAAC
TGCCGTGCCTTCCCGTGACTTTATCCCCCCCTGCATCACCCTGGCGGGCTCACCCGCGCTCCTCGACCTG
CTCCAGGAAATCCGGGAACAGCTGGCCTCACGCTGCCGCTGGCTGGAGGGATACAAGAAGGAACGCGGCA
TTCAGGCGGCCGAGTTCGGTTCCAAGGATCTGGTCTTCCTCCTAGCCCTCAGAACCGTGAGCCGGCACCT
CGCCAGGCTTAGCCACTGGATCGAGGCGGTTGAGGTTCACCCTTGGCAGGTTTACGGGCTTTTGGGGGAG
CTCGCCGCGGAACTCACCTGCTTCTCGGAGAGCATCGGTGCCTTCGGTGAGTCCGTAGCCGACGGGGGAA
GGCTCATGCCGCAGTACCGGCACCAAGAGCTGGCGTGGAGCTTTCGGCTGGCCCGTGATCTCATCGTCCA
GTTGCTGAACGAGGTGACCGCGGGGCCGGAATACGCCCTGACCCTCGCCTTCGACGGGACCTGGTTCGCC
TCCGATCTCAAGCCCGCGCACTTCCAGGGTCACAGCAGGTTTTACCTGGTGCTGAATACGAACGAGGATC
CGAAACTCGTCCTGGCTTCGGTCGCGACCGCAGCGAAATTGACCGCACGCGAACGGCTGCCGCTGCTGAT
CTCCCAGGCGCTCCCGGGGATCGCCCTGGAGTATATTCCCGATCCCCCCCGCGAACTGCCGCACCGCTCG
ACCTCCCTCTTTTTCAGCATAGACAGCCGCTGCGATCAGTGGAAGCTGGTGCAGAAGTGGAACAACATCG
CCCTCAGCTGGGACCAGGCCCCAGCTGACCTAGAAGTGCAGGTCATGATCGTTGCCAGGTCCTAG