SecReT6
Protein ID: 197119419
SecReT6 ID296
T6SS typei4a
Gene symbol-
Locus tagGbem_3048
StrainGeobacter bemidjiensis Bem
Repliconchromosome [GenBank: NC_011146] [Browse all T6SS(s) in this replicon]
Location [Strand]3516900..3517388 [-]
Productlipoprotein
NoteTssJ
UniProt IDB5E881
KEGG IDgbm:Gbem_3048
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-23, Aligned region: 13..156
Protein Sequence: 162 a.a.     [Download]
>gi|197119419|ref|YP_002139846.1| lipoprotein [Geobacter bemidjiensis Bem]
MKRMLVAVLLALIGVGCSTGGGTVGARGSDSKDSVLFEIAADPQLNRYEKNSHALVLCLYQLSDADSFTR
LAQGTEGMPKLLECGRFDGTVVHVRQVVVQPGQELKEIAERGNGARYLGIATGYYSTGKKKMTALATIPE
DQRESVLRIELGAQEIGQVRVK
 
Nucleotide Sequence: 489 bp     [Download]
>ref|NC_011146.1|:c3517388-3516900 lipoprotein [Geobacter bemidjiensis Bem]
ATGAAAAGAATGCTTGTTGCGGTGCTGCTGGCTTTAATTGGTGTCGGTTGCTCGACCGGCGGCGGAACGG
TCGGCGCGCGGGGAAGTGATTCGAAGGACTCGGTCCTGTTCGAAATAGCGGCGGACCCTCAACTGAACCG
CTATGAGAAAAACTCACATGCGCTCGTGCTTTGCCTCTACCAGTTAAGCGATGCCGACAGCTTCACGCGG
CTGGCCCAGGGAACCGAGGGGATGCCGAAACTTCTTGAATGCGGCAGGTTCGACGGGACGGTGGTGCACG
TACGGCAGGTGGTGGTGCAGCCTGGGCAGGAACTGAAAGAGATTGCCGAGAGGGGAAACGGCGCACGGTA
CCTCGGAATAGCTACCGGCTACTACAGCACAGGCAAAAAGAAGATGACCGCGCTCGCGACGATTCCGGAG
GACCAGAGGGAGAGCGTGCTCCGTATCGAACTGGGGGCACAGGAAATAGGACAGGTGAGGGTGAAATGA