SecReT6
Protein ID: 197247752
SecReT6 ID298
T6SS typei1
Gene symbol-
Locus tagSeAg_B1098
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]1093986..1095347 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB5F220
KEGG IDsea:SeAg_B1098
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 8.80E-46, Aligned region: 93..156
DUF3702 [PF12486], Evalue: 8.80E-46, Aligned region: 262..271
DUF3702 [PF12486], Evalue: 8.80E-46, Aligned region: 292..438
ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 240..265
Protein Sequence: 453 a.a.     [Download]
>gi|197247752|ref|YP_002146006.1| ImpA domain-containing protein [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MSQDALTHIIVTGQDPRGLPEFSALREEINKSSHPSQPELNWKLVESLALAIFKAHGVDLHTATYYTLAR
TRTHGLAGFCEGVELLAAMISHDWDKFWPQDESARTGMLDWLNSRTGNILRQQLSFSGADLPLLYRTERA
LQLICDKLQQVELKRQPHVENLLYFVQNTRKRLEPPPKSSVDIPPQTTVRTLIYAPESTQPVTEENLPPL
PELPEMKVEVHHGAVEDPEPVARATSGRTIKGFMAGVVCAAAVAAVLWWWQVYPMQQQLAQVRDTAQGAA
TLWLASPELDSYGQRLQQLPDASPLQLLEAGMQMMRTADSRWPESLQQQQATAQWNEILKTRAQSSPQMR
GWQQARQNLRDFADLMMQRETEKQGFTLSYIKTVTWQAERLLNQETPLESLLTQYQDARAQGRNTEALEK
QINERLDGVLSRWLLLKNNILTTTATETEAGKR
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|197247352|ref|NC_011149.1|:c1095347-1093986 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
ATGAGTCAGGACGCACTCACGCACATTATTGTTACCGGCCAGGATCCGCGCGGCCTGCCGGAGTTCAGCG
CCCTGCGGGAAGAGATCAACAAATCGTCTCACCCGTCGCAGCCGGAGCTGAACTGGAAACTGGTGGAATC
GCTGGCGCTGGCCATTTTTAAAGCCCATGGCGTGGATCTGCACACGGCCACTTATTACACCCTGGCGCGC
ACCCGCACGCACGGCCTGGCCGGATTTTGCGAAGGGGTGGAGCTGCTGGCGGCCATGATAAGCCACGACT
GGGACAAATTCTGGCCACAGGATGAGTCAGCCCGCACCGGGATGCTCGACTGGCTTAATTCGCGCACCGG
CAATATTCTGCGCCAGCAGCTGTCCTTCTCCGGCGCGGACCTGCCGTTGCTGTACCGCACCGAACGGGCG
TTACAGTTGATTTGCGACAAACTCCAGCAGGTGGAACTGAAACGCCAGCCGCATGTGGAGAACCTGCTTT
ATTTTGTGCAGAACACACGTAAGCGGCTTGAGCCGCCGCCGAAAAGCAGCGTGGACATTCCGCCGCAGAC
CACCGTCAGAACGTTGATCTACGCCCCGGAGAGCACGCAGCCCGTCACGGAGGAAAACCTTCCGCCCCTG
CCTGAGTTGCCGGAAATGAAGGTGGAAGTCCACCACGGCGCGGTGGAGGATCCAGAGCCTGTCGCCAGGG
CCACGTCAGGCCGGACTATAAAAGGCTTTATGGCCGGTGTCGTCTGCGCTGCGGCTGTCGCTGCCGTCCT
CTGGTGGTGGCAGGTGTACCCGATGCAACAGCAACTGGCGCAGGTCAGGGACACGGCGCAGGGCGCGGCA
ACGCTCTGGCTGGCCTCGCCTGAACTGGACAGCTACGGGCAGCGGTTACAACAGCTTCCCGACGCCTCGC
CGCTGCAACTGCTGGAGGCGGGGATGCAGATGATGCGAACCGCAGACAGCCGCTGGCCGGAAAGTCTGCA
ACAGCAGCAGGCGACAGCGCAGTGGAATGAAATCCTGAAAACCCGCGCGCAAAGCAGCCCGCAAATGCGC
GGCTGGCAGCAGGCGCGCCAGAATCTGCGTGACTTTGCTGACCTGATGATGCAGCGGGAAACGGAGAAGC
AGGGCTTTACCCTCTCCTATATTAAAACGGTGACCTGGCAGGCGGAACGCCTGCTGAATCAGGAAACGCC
GCTGGAATCCCTGCTGACGCAGTACCAGGATGCCCGCGCTCAGGGACGGAATACGGAGGCGCTGGAAAAA
CAAATTAATGAACGGCTGGATGGGGTGTTAAGCCGCTGGCTGTTGCTGAAAAACAATATACTGACGACGA
CGGCAACCGAAACGGAAGCCGGAAAGAGATAG