SecReT6
Protein ID: 197248170
SecReT6 ID298
T6SS typei1
Gene symbol-
Locus tagSeAg_B1114
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]1114691..1116832 [+]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDB5F2N6
KEGG IDsea:SeAg_B1114
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.20E-64, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 1.60E-26, Aligned region: 366..458
Gp5_C [PF06715], Evalue: 0.0068, Aligned region: 500..522
Gp5_C [PF06715], Evalue: 0.0068, Aligned region: 524..546
Gp5_C [PF06715], Evalue: 0.0068, Aligned region: 548..570
Gp5_C [PF06715], Evalue: 0.0068, Aligned region: 614..632
Protein Sequence: 713 a.a.     [Download]
>gi|197248170|ref|YP_002146022.1| type VI secretion system Vgr family protein [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MSTGLRFTLEVDGLPPDALVVESFHLSQSLSTLFSLDISLVSQQLLNIDFSQVLEQPAHLKIWQGTEIQR
RVNGIVTWFEQGENDGHQMLYSMKVRPPVWRAALRQNSRIFQNEDIKSILGTILQENGVTDWSPLFSEPH
PAREFCVQYSETDYDFLARMAAEEGIFFYEEHAQTSDDQSLVLCDTVRFLPEAFEIPWNPNTRTEVSTPC
VSQFRHSAQIRPSSVIGKDYTFKRPGWAGRFEHQGEHQDYQRTQYEVFDYPGRFKDGHGQNFTRWQMEGW
RNNAEVAQGKSRSPAIWPGRRIQLTEHPQASLNREWQVVSSDLHGSQPQAAAGRSGSGTSLENHFTVIPA
DRTWRPRPLPKPSVDGPQSAVVTGPEGEEIFCDEHGRVRVKFNWDRYNPANQDSSCWIRVVQAWAGPGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRSPGSLPGTKTQMTIRSKTYKGSGFNELMFDDATGK
ERVYIHAQKNMNTEVLHNRTTDVTNNHAETIGNNQVIAVTNNQIQTIGVNQIQNVGVNQVEKVGSNQVIK
VGTNQIETVGLLRALNVGVVYQTTVGAIMNTSVAMMQSSQVGLHKSLMVGMGYSVNVGNKVTFSVGKTRS
DNAGQTAIYSAGEHLELRCGKARLVMTKDGKIFLNGTKIDLEGAESVNGDALTINWNCGATETVPDAPKD
DSPEPKMPDMRKF
 
Nucleotide Sequence: 2142 bp     [Download]
>gi|197247352|ref|NC_011149.1|:1114691-1116832 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
ATGTCAACAGGATTACGTTTCACACTGGAGGTGGACGGCCTGCCACCGGATGCGCTGGTCGTGGAGTCCT
TTCACCTGAGCCAGTCCCTTTCCACGTTATTTTCCCTCGATATCTCGCTGGTCAGCCAGCAGCTGCTTAA
TATTGACTTCTCCCAGGTACTGGAACAACCGGCGCACCTGAAAATCTGGCAGGGCACGGAGATACAGCGC
CGGGTGAACGGCATCGTGACCTGGTTTGAGCAGGGGGAAAACGACGGACACCAGATGCTGTACAGCATGA
AAGTTCGCCCGCCGGTGTGGCGCGCCGCGCTGCGCCAGAACTCGCGTATTTTCCAGAACGAAGACATAAA
AAGCATTCTCGGGACGATACTGCAGGAAAACGGCGTGACGGACTGGAGCCCGCTGTTCAGCGAGCCGCAT
CCGGCGCGGGAGTTCTGCGTGCAGTACAGCGAAACGGATTACGACTTTCTGGCGCGGATGGCGGCGGAGG
AAGGTATTTTCTTTTACGAGGAACATGCGCAGACCAGCGACGACCAGAGCCTGGTGCTGTGCGACACGGT
GCGTTTTCTGCCGGAAGCCTTTGAAATCCCATGGAACCCGAACACCCGCACCGAGGTGAGCACGCCGTGC
GTCAGCCAGTTCCGCCACAGCGCGCAAATCCGCCCCTCCTCCGTCATCGGCAAGGACTACACCTTCAAAC
GCCCCGGCTGGGCAGGCCGCTTTGAGCATCAGGGTGAACATCAGGATTACCAGCGCACGCAGTACGAGGT
GTTTGACTATCCGGGGCGCTTCAAGGACGGCCACGGTCAGAACTTCACCCGCTGGCAGATGGAGGGCTGG
CGTAATAATGCCGAAGTGGCGCAGGGGAAAAGCCGTTCGCCGGCGATATGGCCGGGACGGCGTATTCAGC
TGACGGAACACCCACAGGCGAGCCTGAACCGGGAATGGCAGGTGGTGAGCAGTGATTTACACGGCAGCCA
GCCGCAGGCGGCGGCGGGGCGTTCAGGCTCCGGGACGAGCCTTGAAAACCATTTTACGGTCATTCCGGCG
GACAGGACATGGCGGCCACGCCCGCTGCCCAAACCGTCAGTGGACGGCCCGCAGTCGGCAGTGGTCACCG
GCCCGGAAGGGGAAGAAATCTTCTGCGACGAACATGGGCGGGTACGGGTGAAATTTAACTGGGACCGGTA
TAACCCGGCGAACCAGGACAGCTCGTGCTGGATACGGGTGGTACAGGCGTGGGCGGGGCCGGGGTTCGGC
AACCTGGCGATACCGCGGGTGGGGCAGGAAGTGATAGTGGACTTCCTCAACGGCGACCCGGACCAGCCCA
TCATCATGGGGCGCACCTACCACCAGGAAAACCGCTCGCCGGGCAGCCTGCCGGGCACTAAAACGCAGAT
GACCATCCGCTCGAAAACCTATAAAGGCAGCGGGTTTAACGAACTCATGTTCGATGATGCGACAGGGAAG
GAGCGGGTGTATATCCACGCGCAGAAGAACATGAATACCGAGGTGCTGCACAACCGCACCACCGATGTGA
CGAATAACCATGCTGAAACCATTGGCAATAACCAGGTGATCGCTGTCACCAATAACCAGATACAGACCAT
CGGCGTCAACCAGATCCAGAACGTTGGCGTCAACCAGGTGGAGAAAGTGGGCAGCAATCAGGTGATCAAG
GTGGGGACAAACCAGATTGAAACGGTGGGACTCCTCCGCGCCCTGAATGTGGGCGTGGTGTACCAGACTA
CGGTGGGCGCCATTATGAACACCTCAGTGGCCATGATGCAGTCTTCACAGGTGGGCCTGCATAAATCGCT
GATGGTGGGGATGGGGTACAGCGTTAATGTGGGGAACAAAGTCACCTTCTCGGTGGGGAAAACAAGGTCA
GACAATGCCGGGCAGACAGCGATTTATTCTGCGGGTGAACATCTGGAGCTTCGCTGCGGTAAAGCCCGGC
TGGTAATGACGAAGGACGGAAAAATTTTCCTTAACGGAACGAAAATTGATCTGGAAGGTGCGGAAAGCGT
CAATGGTGATGCGCTGACGATCAACTGGAACTGCGGCGCAACAGAAACCGTGCCGGATGCGCCGAAGGAT
GACTCGCCGGAGCCGAAGATGCCGGATATGAGGAAGTTCTGA