SecReT6
Protein ID: 197248442
SecReT6 ID298
T6SS typei1
Gene symbol-
Locus tagSeAg_B1100
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]1098898..1100310 [-]
Producttype VI secretion-associated protein, family
NoteTssA
UniProt IDB5F222
KEGG IDsea:SeAg_B1100
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.60E-09, Aligned region: 52..109
ImpA-rel_N [PF06812], Evalue: 4.60E-09, Aligned region: 395..407
Protein Sequence: 470 a.a.     [Download]
>gi|197248442|ref|YP_002146008.1| type VI secretion-associated protein, family [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MDLRDPNTWISHLLENLPDDKLACALKDDNPGWEYIDGEMLKLGSLAHSQLDIPEIQRRGLVILASESKD
FRLLAHLLRTLQHAGDPLLALRLLALYVEHYWTVAAPQNAAHKQRFATQVLKRFETGVESFAETARTAQR
DSLLAELAKLAQRWQEQNIPALTQAVDDLSSQYRRAFRGAAPVPPAAGPSTHPAPVSATPSAPVSPSAPA
ATTAPAVDIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQAITSVPQAESDGRTPLAAVPAD
MTADYQARLNNADLALWQQVEKSLLLAPYWLDGHYLSAQAAQRLGYTSAAEAIRDEVVRFLARLPQLATL
LFNDRTPFISEQTKQWLAASPGSQTAPMVRTSEDTEAVRQCFSEQGLEAALRYLETLPEGDPRDRFHRQY
LGAQLLEEAGMAQLAQQQYRMLFKAGLRMTLAEWEPSLLEQLENKLTAEQ
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|197247352|ref|NC_011149.1|:c1100310-1098898 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
ATGGACTTACGCGACCCGAATACCTGGATTTCGCACCTGCTGGAAAATCTGCCGGATGACAAACTGGCCT
GCGCGCTGAAAGACGATAATCCCGGCTGGGAATATATCGACGGCGAAATGCTTAAACTCGGCTCGCTGGC
GCACAGCCAGCTGGATATCCCGGAAATTCAGCGCCGGGGGCTGGTGATCCTGGCCTCGGAAAGCAAGGAT
TTTCGCCTGCTGGCCCATCTGCTGCGCACCCTGCAACATGCCGGTGATCCGCTGCTGGCGCTGCGTCTGC
TGGCGCTGTACGTGGAGCATTACTGGACTGTGGCGGCACCGCAAAATGCGGCACATAAACAGCGTTTCGC
CACCCAGGTGCTGAAACGCTTTGAAACCGGCGTGGAGAGTTTCGCAGAGACAGCCCGTACCGCGCAGCGC
GACAGCCTGCTGGCTGAACTGGCGAAACTGGCGCAGCGCTGGCAGGAGCAGAATATCCCGGCGCTGACAC
AGGCCGTCGATGACCTCTCGTCGCAGTATCGCCGGGCATTTCGCGGGGCCGCCCCGGTGCCGCCAGCGGC
TGGCCCGTCCACGCATCCGGCTCCGGTTTCGGCCACGCCGTCCGCCCCGGTATCACCGTCTGCGCCTGCG
GCGACGACGGCGCCAGCGGTGGATATCGACAGCCATGACGACAAAGCCTGGCGCGACACGCTGCTGAAAG
TGGCCGCCATTCTCTGTGAGCGCCAGCCGGATTCACCGCAGGGCTACCGCCTGCGCCGCCATGCGTTATG
GCAGGCCATTACATCCGTCCCCCAAGCCGAAAGCGACGGGCGCACACCGCTGGCGGCGGTGCCTGCCGAC
ATGACCGCCGATTACCAGGCGCGGCTGAACAACGCCGATCTGGCGCTCTGGCAACAGGTGGAAAAAAGCC
TGCTGCTGGCCCCGTACTGGCTCGATGGTCATTACCTTTCAGCGCAGGCCGCACAACGCCTGGGCTACAC
CAGCGCGGCAGAAGCCATCCGGGATGAGGTGGTCCGTTTTCTCGCCCGCCTGCCGCAACTTGCCACCCTG
CTGTTTAATGACCGCACGCCGTTTATCAGCGAACAGACAAAACAGTGGCTGGCGGCGTCTCCGGGTAGTC
AGACAGCCCCGATGGTGCGGACCAGTGAAGACACCGAGGCTGTCCGCCAGTGTTTCAGCGAGCAGGGGCT
GGAGGCCGCGCTGCGATACCTGGAAACCCTGCCGGAAGGCGATCCGCGCGATCGGTTCCACCGGCAGTAT
CTTGGCGCGCAACTGTTAGAAGAAGCCGGGATGGCGCAACTGGCACAGCAACAGTACCGGATGTTGTTTA
AAGCAGGGCTGCGCATGACGCTGGCTGAATGGGAGCCGTCCCTGCTGGAACAACTGGAAAACAAACTCAC
GGCAGAACAGTAA