SecReT6
Protein ID: 197249126
SecReT6 ID298
T6SS typei1
Gene symbol-
Locus tagSeAg_B1094
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]1090415..1091650 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB5F216
KEGG IDsea:SeAg_B1094
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-18, Aligned region: 2..56
ImpA-rel_N [PF06812], Evalue: 1.50E-18, Aligned region: 196..221
DUF3702 [PF12486], Evalue: 6.90E-14, Aligned region: 49..112
DUF3702 [PF12486], Evalue: 6.90E-14, Aligned region: 218..227
DUF3702 [PF12486], Evalue: 6.90E-14, Aligned region: 248..310
Protein Sequence: 411 a.a.     [Download]
>gi|197249126|ref|YP_002146002.1| ImpA domain-containing protein [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MESLALAIFKAHGVDLHTATYYTLARTRTHGLAGFCEGVELLAAMISHDWDKFWPQDESARTGMLDWLNS
RTGNILRQQLSFSGADLPLLYRTERALQLICDKLQQVELKRQPHVENLLYFVQNTRKRLEPPPKSSVDIP
PQTTVRTLIYAPESTQPVTEENLPPLPELPEMKVEVHHGAVEDPEPVARATSGRTIKGFMAGVVCAAAVA
AVLWWWQVYPMQQQLAQVRDTAQGAATLWLASPELDSYGQRLQQLPDASPLQLLETGMQMMRTADSHWPE
SLQQQQATAQWNEILKTRAQSSPQITQWEYIYKNNWIRWITPNIKWTRYLFNNPQIMKFGVGAAAMTEGI
VKGTRYSVLFSGAFHVLEFIFKSEYDFADFFVDVSMDVAKLMVAQIVLKAVAGILDFLALR
 
Nucleotide Sequence: 1236 bp     [Download]
>gi|197247352|ref|NC_011149.1|:c1091650-1090415 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
GTGGAATCGCTGGCGCTGGCCATTTTTAAAGCCCATGGCGTGGATCTGCACACGGCCACTTATTACACCC
TGGCGCGCACCCGCACGCACGGCCTGGCCGGATTTTGCGAAGGGGTGGAGCTGCTGGCGGCCATGATAAG
CCACGACTGGGACAAATTCTGGCCGCAGGATGAGTCAGCCCGCACCGGGATGCTTGACTGGCTTAATTCG
CGCACCGGCAATATTCTGCGCCAGCAGCTGTCCTTCTCCGGCGCGGACCTGCCGTTGCTGTACCGCACCG
AACGGGCGTTACAGTTGATTTGCGACAAACTCCAGCAGGTGGAACTGAAACGCCAGCCGCATGTGGAGAA
CCTGCTTTATTTTGTGCAGAACACACGTAAGCGGCTTGAGCCGCCGCCGAAAAGCAGCGTGGACATTCCG
CCGCAGACCACCGTCAGAACGTTGATCTACGCCCCGGAGAGCACGCAGCCCGTCACGGAGGAAAACCTTC
CGCCCCTGCCTGAGTTGCCGGAAATGAAGGTGGAAGTCCACCACGGCGCGGTGGAGGATCCAGAGCCTGT
CGCCAGGGCCACGTCAGGCCGGACTATAAAAGGCTTTATGGCCGGTGTCGTCTGCGCTGCGGCTGTCGCT
GCCGTCCTCTGGTGGTGGCAGGTGTACCCGATGCAACAGCAACTGGCGCAGGTCAGGGACACGGCGCAGG
GCGCGGCAACGCTCTGGCTGGCCTCGCCTGAACTGGACAGCTACGGGCAGCGGTTACAACAGCTTCCTGA
CGCCTCGCCGCTGCAACTGCTGGAAACAGGTATGCAGATGATGCGAACAGCAGACAGCCACTGGCCGGAA
AGTCTGCAACAGCAGCAGGCGACAGCGCAGTGGAATGAAATCCTGAAAACCCGCGCGCAAAGCAGCCCGC
AAATTACTCAATGGGAATACATATATAAAAATAACTGGATACGCTGGATTACGCCAAATATTAAATGGAC
CCGATATCTCTTTAACAATCCGCAAATAATGAAGTTCGGTGTCGGAGCAGCCGCCATGACAGAAGGGATA
GTCAAGGGGACCAGGTACAGTGTATTGTTCAGTGGTGCATTTCATGTACTGGAATTTATATTTAAATCAG
AATATGATTTTGCTGACTTTTTCGTTGATGTCTCTATGGATGTTGCCAAACTTATGGTTGCCCAAATTGT
TCTTAAAGCAGTTGCTGGTATTTTGGACTTTCTGGCGCTCCGATAA