SecReT6
Protein ID: 197249936
SecReT6 ID298
T6SS typei1
Gene symbol-
Locus tagSeAg_B1105
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]1105891..1106424 [-]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDB5F2M7
KEGG IDsea:SeAg_B1105
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.80E-33, Aligned region: 17..170
Protein Sequence: 177 a.a.     [Download]
>gi|197249936|ref|YP_002146013.1| type VI secretion lipoprotein, VC_A0113 family [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MTGRGFLAWAMVALFTLALCGCETVKKIGEVIKNPDIQVGKLADQSSQVTITLLTEPDANINADGEAAAV
DVQLVYLSDDSKFQAADYDQIATTALPDALGKNYIDHQDFSLLPDTMKTLPQVKLDEKTQFIGVIAYFSD
DQTTEWKQIEPVEGTGHNYRLLVHIRQSSIEMKKEDD
 
Nucleotide Sequence: 534 bp     [Download]
>gi|197247352|ref|NC_011149.1|:c1106424-1105891 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
ATGACAGGCCGTGGTTTCCTCGCCTGGGCGATGGTGGCGTTGTTCACCCTCGCCTTATGCGGTTGTGAAA
CGGTAAAAAAAATCGGCGAGGTGATCAAAAACCCGGATATTCAGGTCGGTAAGCTGGCAGACCAGTCTTC
GCAGGTGACGATTACGCTGCTGACGGAGCCGGATGCCAATATCAACGCGGACGGTGAAGCGGCTGCGGTG
GACGTGCAGCTGGTTTATCTGAGCGATGACTCAAAATTTCAGGCGGCCGACTACGACCAGATAGCCACCA
CCGCACTGCCCGACGCGCTGGGGAAAAACTATATCGATCACCAGGATTTCAGCCTGCTGCCCGACACCAT
GAAAACCCTGCCGCAGGTGAAGCTGGATGAGAAAACGCAGTTTATCGGCGTGATTGCCTATTTTTCCGAC
GACCAGACCACGGAATGGAAGCAAATCGAACCGGTAGAAGGGACAGGACACAACTACCGCCTGCTGGTGC
ATATCCGGCAGAGCAGTATTGAAATGAAAAAAGAGGATGATTAA