SecReT6
Protein ID: 197250629
SecReT6 ID298
T6SS typei1
Gene symbolvasA
Locus tagSeAg_B1108
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]1108784..1110637 [-]
Producttype VI secretion protein, family
NoteTssF
UniProt IDB5F2N0
KEGG IDsea:SeAg_B1108
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.10E-192, Aligned region: 5..617
Protein Sequence: 617 a.a.     [Download]
>gi|197250629|ref|YP_002146016.1| type VI secretion protein, family [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MEFEERYYRQELDHLRQLSKLLATEKPHLARFLAEKEADPDIERLLEGVAFLTGNLRQKIEDEFPELTHG
LIRMLWPNYLRPVPSMTLIEYAPDMDKTSVPVLIPRNEQFTTGAKGTQGNAVLSAYSGNEHDVAPPCTFT
LCRDIWLLPVQLDQVENRSTPRHGIIDITFAVAPGTDFATLDLNRLRFWLGNDDNYTRYQLYLWFCEYLQ
GAELMAGGQSIPMPEFMLKAVGFESEDAMLPWPGNVHSGYRVLQEFFCYADSFLFFDACGIPALPDRLKE
NRFTLRLRFSRPLPADIRLRDDSLRLYCAPAINLFAHHAEAITLDHQRQDYALVPSRHFPDHYDIFSVNS
VVSQTQGKHRKADLGRPVITEAARHWPAFESFRHQMEYSRKREVVYWQHRTRTSLFHRGFDHTLAFIHAD
GSLPDASLLNNEVVSVSLTCTNRELPVQLRPGDITGTTGKNASVASFRNITRPTRPLWPVIDGSLHWSLL
SAMNLNYLSLLDADALKQVIANFDRHAIHHPQMARLSQQKLDAIERLETTPVDRLFTGIPVRGLASTLSI
HPEPFVCEGEMYLLGAVLSHFLSLYASVNSFHMLTVVNTESQESWKWAERTGQHPLI
 
Nucleotide Sequence: 1854 bp     [Download]
>gi|197247352|ref|NC_011149.1|:c1110637-1108784 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
ATGGAATTCGAAGAACGCTATTACAGGCAGGAGTTGGATCACCTGCGGCAGTTGAGCAAGCTGCTGGCGA
CCGAAAAGCCGCATCTGGCCCGGTTTCTGGCAGAAAAAGAGGCCGATCCGGATATCGAGCGTTTGCTGGA
GGGCGTGGCCTTTCTGACCGGCAATCTGCGCCAGAAAATCGAGGATGAGTTTCCGGAGCTGACGCACGGA
CTGATCCGGATGCTGTGGCCCAATTATCTGCGCCCGGTGCCGTCGATGACGCTGATTGAATATGCGCCGG
ATATGGATAAAACCTCCGTGCCGGTACTGATCCCCCGTAATGAGCAGTTCACAACCGGGGCGAAGGGGAC
TCAGGGAAACGCGGTATTGTCTGCGTATTCCGGCAATGAGCACGATGTAGCCCCGCCCTGTACGTTCACT
CTTTGCCGGGATATCTGGCTGTTACCCGTTCAACTGGATCAGGTTGAAAATCGCAGTACGCCCCGCCACG
GCATTATTGATATTACGTTTGCCGTCGCACCGGGCACTGATTTTGCCACGCTGGATCTGAACAGGCTGCG
CTTCTGGCTGGGCAACGATGATAACTATACCCGCTACCAGCTTTATCTGTGGTTTTGTGAATATTTACAG
GGCGCAGAGTTGATGGCGGGCGGGCAGTCGATCCCGATGCCTGAATTTATGCTGAAAGCGGTGGGTTTTG
AGTCAGAGGACGCCATGCTGCCCTGGCCCGGTAATGTCCACAGCGGCTACCGTGTTCTCCAGGAGTTTTT
CTGCTACGCCGACAGTTTTCTGTTTTTCGATGCCTGTGGCATTCCGGCATTGCCAGACCGGTTGAAGGAG
AACCGTTTCACTCTGCGGCTACGGTTTTCACGCCCCTTACCGGCAGATATCCGGCTGCGGGATGATTCCC
TGCGCTTATATTGTGCGCCCGCCATTAATCTGTTTGCCCACCATGCCGAAGCCATCACGCTGGATCATCA
GCGGCAGGATTACGCTCTGGTTCCCAGCCGTCATTTTCCGGATCATTACGATATTTTTTCGGTTAACAGC
GTGGTGAGTCAGACACAGGGGAAGCACAGAAAAGCGGATCTTGGACGGCCAGTGATCACAGAGGCCGCGC
GCCACTGGCCTGCTTTTGAGAGTTTCCGCCACCAGATGGAGTACAGCCGTAAGCGGGAAGTGGTCTACTG
GCAGCACCGGACCAGGACCTCGCTGTTTCACCGGGGCTTTGATCATACCCTGGCTTTTATTCATGCCGAT
GGCAGCCTCCCGGATGCCTCACTGCTTAATAATGAAGTGGTTTCGGTATCGCTGACCTGCACCAACCGGG
AGTTGCCGGTACAGCTACGGCCCGGCGATATCACCGGTACGACAGGTAAAAACGCGTCAGTGGCGTCATT
TCGCAATATCACCCGCCCCACCAGACCGCTCTGGCCGGTGATTGACGGCAGCCTGCACTGGTCGTTGCTG
TCTGCCATGAACCTGAATTATCTGTCGTTGCTGGATGCTGATGCGCTCAAACAGGTTATCGCCAATTTTG
ATCGCCACGCCATTCATCATCCGCAGATGGCCCGTCTGTCACAACAGAAGCTGGACGCCATTGAACGGCT
GGAAACTACGCCTGTTGATCGCCTGTTTACCGGCATACCGGTGCGCGGGCTGGCGTCCACCCTGTCCATT
CATCCGGAGCCGTTTGTCTGCGAGGGTGAAATGTATCTGCTGGGCGCGGTGCTGTCGCATTTTCTGTCGC
TGTACGCCAGCGTCAATTCGTTCCACATGCTGACCGTCGTTAATACGGAAAGCCAGGAGTCATGGAAATG
GGCGGAAAGAACCGGGCAACACCCGCTCATCTGA