SecReT6
Protein ID: 197250878
SecReT6 ID298
T6SS typei1
Gene symbol-
Locus tagSeAg_B1107
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]1107732..1108820 [-]
Producttype VI secretion protein, family
NoteTssG
UniProt IDB5F2M9
KEGG IDsea:SeAg_B1107
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-88, Aligned region: 34..349
Protein Sequence: 362 a.a.     [Download]
>gi|197250878|ref|YP_002146015.1| type VI secretion protein, family [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MGGKNRATPAHLSPDETPAQDEQRTLREPLFQDACACNFFALSELLHRLASEGGETPVLSLDTPPAQETI
RFHADASLGFPVSDVSALEQDASGLFRMTTTFMGLQGSQSPLPGYYLDHLAWKSAHEQSPVSDFLDMFSH
RLTQFVWHIWRKYRYHVAFRNGGVDAFSQRMYSLVGLGHRQLRDSLPVNHSKMLAYAGILANPGRSPEIV
CTLVAHCFDLNLSDVTLQNWQRRMVDIEPDQQNSLGCYTIKNGEKLAGRSVLGNFVLGTRVPDLSGKFQL
SINHLSRKQFLSFLPSGENFLPLAMFVSFVLRDQLAWDLHLGLAPDQVGIMRLGDNKSALLGWTSFLGEP
GEHPSVTIRVRE
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|197247352|ref|NC_011149.1|:c1108820-1107732 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
ATGGGCGGAAAGAACCGGGCAACACCCGCTCATCTGAGTCCGGACGAGACTCCGGCGCAGGATGAACAAC
GCACGCTGCGGGAGCCGTTGTTTCAGGATGCCTGCGCCTGTAATTTTTTCGCGCTCTCTGAGCTGCTGCA
CCGGCTGGCATCAGAAGGCGGCGAAACGCCAGTGTTATCCCTGGATACCCCTCCGGCGCAGGAAACCATT
CGTTTCCATGCGGACGCCAGCCTGGGATTTCCGGTAAGCGATGTCAGCGCGCTGGAGCAGGATGCTTCCG
GATTGTTCCGGATGACCACCACCTTTATGGGATTGCAGGGCAGCCAGTCGCCCCTCCCCGGCTATTACCT
TGATCACCTGGCCTGGAAATCCGCGCACGAGCAGAGTCCGGTCAGCGATTTTCTGGATATGTTCAGCCAT
CGCCTGACGCAGTTTGTCTGGCATATCTGGCGTAAGTACCGTTACCACGTAGCGTTCCGTAACGGCGGCG
TGGATGCGTTCTCGCAGCGGATGTATTCCCTGGTGGGGCTGGGCCACCGGCAGCTTCGCGACAGCCTGCC
CGTTAACCACAGTAAGATGCTGGCCTATGCCGGGATACTGGCAAATCCGGGACGTTCGCCGGAGATCGTC
TGCACACTGGTTGCGCACTGTTTCGATTTAAATTTATCGGACGTGACGCTGCAAAACTGGCAGCGGCGGA
TGGTGGATATCGAGCCGGATCAGCAGAACAGTCTTGGATGTTACACGATTAAAAATGGCGAAAAACTGGC
TGGGCGATCGGTGCTGGGCAATTTTGTCCTCGGTACGCGGGTTCCCGATCTCAGCGGTAAATTTCAGTTA
AGTATTAACCACCTGAGCCGCAAGCAGTTTCTCTCGTTCCTGCCGTCAGGAGAAAATTTTCTGCCGCTGG
CGATGTTTGTCTCCTTCGTCCTGCGCGATCAGCTTGCCTGGGATTTACACCTGGGGCTGGCCCCGGATCA
GGTGGGGATTATGCGGCTGGGCGATAACAAGAGCGCGCTGCTGGGCTGGACGTCATTTCTCGGCGAGCCG
GGAGAGCATCCCTCAGTCACCATCAGGGTCAGGGAGTAA