SecReT6
Protein ID: 197251349
SecReT6 ID298
T6SS typei1
Gene symbol-
Locus tagSeAg_B1111
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]1112818..1113321 [-]
Producttype VI secretion protein, family
NoteTssB
UniProt IDB5F2N3
KEGG IDsea:SeAg_B1111
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.90E-54, Aligned region: 7..163
Protein Sequence: 167 a.a.     [Download]
>gi|197251349|ref|YP_002146019.1| type VI secretion protein, family [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MSKDYNGSVAPKERINISYIPKTDGEPSEVELPLNMLIVGDTGNSQETAPLDERQMVSIDKHSFNSVMAE
ASISLNFAVPASLKDDAKDGDEMNISLEIKSLNDFSPDSVAKQVPELNKLLELREALTALKGPLGNLPAF
RAQLQALLENEESREQLLREISQAENQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|197247352|ref|NC_011149.1|:c1113321-1112818 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
ATGAGCAAAGATTATAACGGCAGCGTGGCACCCAAAGAACGCATTAATATTTCTTATATTCCAAAAACGG
ACGGTGAGCCTTCTGAGGTGGAATTACCCCTTAATATGTTGATAGTGGGGGATACCGGAAACTCACAGGA
AACAGCGCCACTTGATGAACGCCAGATGGTTTCTATCGACAAACATTCATTCAATTCAGTGATGGCAGAA
GCGTCCATTAGCCTGAATTTTGCAGTTCCGGCATCATTGAAGGACGACGCAAAAGATGGCGATGAGATGA
ATATCTCGCTGGAAATCAAATCCCTGAACGATTTTTCTCCGGACAGTGTGGCAAAACAGGTGCCGGAGTT
GAACAAATTGCTGGAACTACGCGAAGCGCTGACAGCATTAAAAGGGCCGCTGGGTAATCTGCCTGCATTT
CGCGCCCAGCTTCAGGCATTGCTGGAAAATGAAGAATCCCGCGAACAGTTACTGCGGGAGATCAGCCAGG
CAGAAAACCAGTAA