SecReT6
Protein ID: 197251439
SecReT6 ID298
T6SS typei1
Gene symbol-
Locus tagSeAg_B1106
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]1106421..1107707 [-]
Producthypothetical protein
NoteFha
UniProt IDB5F2M8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 428 a.a.     [Download]
>gi|197251439|ref|YP_002146014.1| hypothetical protein SeAg_B1106 [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MAEEKARQQTLSLHVVNGNELESGRTARCLFTGDGDVGHGSECHWPVQDRHQNVPAKAFSISLHDGAFCL
HPLASPLWLNQAKVTAASDQVQLRQGDEIQTGHLILRVYLNQGGMRHYDEEMATPETIVSNHDLLSDTLL
STDGAPEYPGMPSRHQLADTVVNGFSTDPLQVLQAESLTTRDNPLAGITPARPSAPLSDPAINGGINTPF
MDLPSMYADPHDNEEGMSPADAAQRHLAVTPLLRGLGGSLAVHNTQDADDFLEEAGRTLQAAIQGLLELQ
QRRNSLSDKHLRPLEDNPLRLNMDYATALDVLFAEGKSPVHLAAPAAVSESLRNIRHHEEANRAAIVESL
RVLLDAFSPQSLMRRFVQYRRSHELRKPLDDAGAWQMYCDYYDELASSRQQGFEMLFNEVYAQVYDRVLR
EKQREPEA
 
Nucleotide Sequence: 1287 bp     [Download]
>gi|197247352|ref|NC_011149.1|:c1107707-1106421 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
ATGGCGGAAGAAAAAGCGCGGCAACAGACGCTTTCACTGCATGTCGTTAACGGTAACGAGCTGGAGAGCG
GACGTACCGCACGGTGTCTGTTCACCGGAGACGGCGATGTGGGCCACGGCAGCGAATGCCACTGGCCTGT
TCAGGACCGGCACCAGAACGTTCCGGCGAAGGCGTTCAGCATCAGCCTGCATGATGGCGCATTCTGCCTG
CATCCGCTGGCTTCGCCATTATGGCTGAACCAGGCTAAAGTCACGGCGGCCTCAGACCAGGTGCAGTTAC
GCCAGGGCGATGAGATCCAGACCGGGCATCTGATACTCCGGGTTTATCTGAACCAAGGCGGGATGCGGCA
TTACGATGAGGAGATGGCGACGCCTGAAACTATCGTTTCTAACCACGACCTCCTGTCGGACACGCTGCTG
TCCACGGACGGCGCGCCGGAATATCCGGGAATGCCGTCCCGCCATCAGCTCGCGGATACCGTTGTTAATG
GCTTTTCCACCGATCCGTTGCAGGTGCTCCAGGCTGAAAGTCTGACCACCAGGGACAATCCGCTTGCGGG
TATCACCCCGGCCCGGCCCTCCGCCCCGTTATCCGATCCGGCGATAAACGGCGGGATCAACACGCCGTTT
ATGGATCTGCCGTCCATGTATGCCGATCCACATGATAATGAAGAGGGCATGTCACCAGCAGACGCGGCGC
AGCGCCATCTCGCCGTCACGCCGTTACTGCGCGGGCTGGGGGGATCGCTTGCCGTGCATAACACCCAGGA
CGCCGACGATTTTCTGGAAGAGGCCGGAAGGACATTGCAGGCGGCGATTCAGGGGTTGCTTGAGCTACAG
CAGCGCCGCAACAGCCTGTCAGACAAGCATCTGCGCCCGCTGGAAGATAACCCGCTGCGCCTGAATATGG
ACTACGCCACGGCGCTGGACGTGCTGTTTGCCGAAGGGAAAAGCCCGGTACATCTGGCCGCGCCCGCCGC
CGTCAGCGAGAGCCTGCGCAATATTCGTCATCACGAAGAAGCCAACCGCGCCGCGATTGTGGAATCGCTG
CGCGTGCTGCTGGACGCCTTCTCGCCACAGAGTCTGATGCGCCGTTTTGTGCAGTACCGCCGCAGCCACG
AACTGCGTAAACCGCTGGATGATGCCGGTGCGTGGCAGATGTACTGCGATTATTACGATGAGCTGGCCTC
CAGCCGCCAGCAGGGTTTTGAGATGCTGTTTAACGAAGTGTATGCCCAGGTGTATGACCGGGTGTTGCGT
GAAAAGCAGCGGGAGCCGGAAGCATGA