SecReT6
Protein ID: 197251451
SecReT6 ID298
T6SS typei1
Gene symbol-
Locus tagSeAg_B1097
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]1093488..1093967 [-]
Producttype VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDB5F219
KEGG IDsea:SeAg_B1097
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-26, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|197251451|ref|YP_002146005.1| type VI secretion system effector, Hcp1 family [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MANLSYLTLNGEKQGLISAGCSSMASIGNKAQIAHIDQILVLALEHGVTRNQNVNHLALTIRKPVDKATP
LLNKAITENEILTCDIEFYRTNRFGINEMYYKIQLLKARIASIHLIVPHTVSSSDGQPEENISFIYETFT
HEHCIAGTSAFSTWNTRLF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|197247352|ref|NC_011149.1|:c1093967-1093488 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
ATGGCGAATTTAAGTTATTTGACACTTAATGGAGAAAAACAGGGACTGATTTCAGCGGGGTGTTCATCAA
TGGCATCCATTGGCAATAAGGCACAAATCGCTCACATCGATCAAATTTTAGTCCTGGCCCTTGAACATGG
CGTCACGCGGAATCAAAACGTAAACCACCTTGCTCTGACTATTCGAAAACCAGTGGATAAAGCTACTCCT
TTGTTAAATAAAGCAATTACAGAAAATGAAATTCTGACCTGCGATATTGAGTTTTACCGGACTAATCGCT
TCGGTATAAATGAGATGTATTACAAAATACAGTTGCTTAAAGCCCGTATTGCAAGCATTCATTTAATAGT
TCCACATACGGTAAGCAGCAGTGACGGGCAACCGGAAGAAAATATATCATTTATTTATGAAACATTTACG
CATGAACATTGTATTGCGGGGACCAGTGCATTCAGCACCTGGAATACGCGTCTTTTTTAA