SecReT6
Protein ID: 197251828
SecReT6 ID298
T6SS typei1
Gene symbol-
Locus tagSeAg_B1110
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]1111055..1112527 [-]
Producttype VI secretion protein, EvpB/family
NoteTssC
UniProt IDB5F2N2
KEGG IDsea:SeAg_B1110
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.10E-185, Aligned region: 68..489
Protein Sequence: 490 a.a.     [Download]
>gi|197251828|ref|YP_002146018.1| type VI secretion protein, EvpB/family [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MSLQEEELVSTRTEQGSHAPSLLDEIMAQTRIQPGADGYDIARQGVTAFVASLLQSTSPAEPVNKLAVDS
MIADIDVRISRQMDAIIHAPQFQQLESFWRSMKALVDRVDFRENIKVHVLHVTKAELLEDFEFAPEITQS
GFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTTPDMKLLNYVSAVGAMAHAPFLSSVSPEFMGLKSWTELP
NIKDLYAIFEGPAYTKWRALRDSEDSRYLGLTAPRFLLRQPYSATENPIKSFNYAENVSHSHEHYLWGNT
AWMLASNIADSFAKYRWAPNIIGPQSGGAVKDLPVHLYESMGQIQAKIPTEVLITDRREFELAEEGFITL
TMRKNSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNIWVRQYVADQENPPADVRSRKPLRGAKVEVLDVDGEPGWYQVAISARPHFKYMGASFELSLVGRLDK
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|197247352|ref|NC_011149.1|:c1112527-1111055 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
ATGTCTTTACAGGAAGAAGAACTTGTTTCCACCCGCACTGAACAGGGAAGCCATGCCCCGTCGTTGCTTG
ATGAAATCATGGCACAAACCCGTATCCAGCCCGGCGCTGACGGTTATGATATTGCCCGTCAGGGCGTAAC
GGCTTTTGTTGCCAGCCTCCTGCAATCCACTTCACCTGCAGAACCCGTAAACAAACTGGCCGTGGACAGC
ATGATTGCGGACATCGACGTCCGTATCAGCCGTCAGATGGATGCTATTATTCACGCCCCTCAGTTTCAGC
AACTGGAGTCGTTCTGGCGTTCAATGAAAGCGCTGGTCGATCGCGTTGATTTTCGTGAGAATATTAAGGT
GCATGTCCTCCATGTCACCAAAGCGGAATTGCTGGAAGATTTCGAGTTCGCGCCGGAGATTACCCAGTCC
GGCTTCTATAAGCATGTTTATTCCAGCGGGTTTGGGCAGTTTGGCGGCGAACCCATTGCGGCGGTGCTGG
GCGCATATGAGTTCAAAAATACCACGCCGGATATGAAGCTGCTGAACTATGTCAGCGCCGTCGGCGCAAT
GGCTCACGCGCCGTTCCTTTCTTCCGTGTCGCCGGAGTTTATGGGCCTGAAATCATGGACCGAGCTGCCC
AATATCAAGGATCTCTACGCCATTTTTGAAGGCCCGGCCTATACAAAATGGCGCGCCCTGCGTGATTCCG
AAGATTCCCGCTACCTGGGACTGACCGCGCCGCGTTTTCTGCTTCGCCAGCCCTATTCCGCGACCGAAAA
CCCGATTAAAAGCTTCAACTACGCCGAAAATGTCAGCCACAGCCACGAGCATTATTTGTGGGGCAATACC
GCCTGGATGCTGGCCAGTAATATAGCCGATTCGTTCGCGAAATACCGGTGGGCGCCCAATATTATCGGGC
CGCAGAGCGGCGGCGCAGTAAAAGATCTGCCGGTACATTTATATGAGTCAATGGGGCAGATTCAGGCCAA
GATCCCGACGGAGGTGTTGATCACCGACCGCCGTGAGTTCGAGCTGGCCGAAGAGGGGTTCATCACCCTG
ACCATGCGTAAAAACAGCGATAATGCGGCGTTTTTCTCGGCTAACAGCGTTCAGAAACCCAAGCATTTTC
CGGGCAAAGACGCCGAGACCAACTACAAGCTGGGTACGCAGTTGCCTTATCTGTTCATTATTAACCGCCT
CGCGCACTACATTAAGGTGCTGCAACGCGAGCAGCTTGGGTCGTGGAAAGAGAGAAGCGATCTGGAGCGG
GAGCTGAATATTTGGGTGCGCCAGTATGTCGCCGACCAGGAGAATCCGCCTGCTGATGTCCGCAGCCGTA
AGCCGCTGCGTGGCGCTAAAGTGGAGGTGCTGGATGTGGACGGCGAGCCGGGCTGGTATCAGGTGGCGAT
TTCCGCACGGCCCCACTTTAAATATATGGGCGCGTCGTTTGAATTGTCTTTAGTCGGACGGTTAGATAAG
TGA