SecReT6
Protein ID: 197284627
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0733
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]807789..808262 [-]
Producthypothetical protein
NoteTssD
UniProt IDB4ET45
KEGG IDpmr:PMI0733
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.10E-33, Aligned region: 6..143
Protein Sequence: 157 a.a.     [Download]
>gi|197284627|ref|YP_002150499.1| hypothetical protein PMI0733 [Proteus mirabilis HI4320]
MANSIYLKIIGKSQGDISKGCSTLGSIGNKYQHGHEDQIFVYSFDYDLTRAQNLNHSPVVISKPIDKSSP
LLGVAITNNELLECELEFYRTSSNGNQEKFYTIKLTKASITNISAHYPNSLTHADAQPYEDITIRYESIS
WNHICAGTSGYSISKNI
 
Nucleotide Sequence: 474 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c808262-807789 Proteus mirabilis HI4320 chromosome, complete genome
ATGGCTAATTCAATATATTTAAAGATAATAGGGAAATCTCAAGGTGATATATCCAAAGGGTGCTCTACTT
TAGGATCTATAGGCAATAAATATCAGCACGGACATGAAGATCAGATATTTGTGTATTCATTTGATTATGA
TTTAACTCGAGCACAAAATTTAAATCATTCTCCTGTGGTAATTTCAAAACCTATAGATAAATCTTCACCC
TTACTTGGGGTTGCAATAACAAATAATGAATTATTAGAGTGCGAGCTAGAATTCTATAGAACAAGTTCAA
ACGGCAATCAAGAAAAGTTTTATACCATTAAGCTAACAAAAGCCAGCATTACCAATATATCAGCACATTA
CCCTAATTCACTGACGCATGCAGATGCCCAGCCTTATGAAGATATTACTATTCGATATGAAAGTATCTCT
TGGAACCATATTTGTGCAGGAACATCAGGTTATAGTATCAGCAAAAATATTTAA