SecReT6
Protein ID: 197284629
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0735
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]810082..811437 [-]
Producthypothetical protein
NoteTssA
UniProt IDB4ET47
KEGG IDpmr:PMI0735
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.50E-45, Aligned region: 91..125
DUF3702 [PF12486], Evalue: 2.50E-45, Aligned region: 168..182
DUF3702 [PF12486], Evalue: 2.50E-45, Aligned region: 284..431
ImpA-rel_N [PF06812], Evalue: 6.70E-21, Aligned region: 44..103
ImpA-rel_N [PF06812], Evalue: 6.70E-21, Aligned region: 118..134
Protein Sequence: 451 a.a.     [Download]
>gi|197284629|ref|YP_002150501.1| hypothetical protein PMI0735 [Proteus mirabilis HI4320]
MLSAMKSESLVIKIGGSPLDTPEFIALKTEFNKLSHPARPEISWTLIESLCLSLFKNHGIDLQSGAYYTI
ARLQQHGLSGFTEGCELLANVIVTYWDSLWPEKPNQRTEVLNWFNTKASALLRQQSYQAKDLRLIYRSER
ALQLIIDKLAKTTWEKLPKIENLLWFFQNLAKQIEKQEKQTQQDSAEPVSVPPLVCIQQPSKTTDKAAPT
FVIETPQPASSFTVVAKKMSATRGFIWGCVLSCILFLAIGFGVHLYLKQEMNAITSIPEGAAAKWLFKPQ
LNSYEYHLALLEKRSPLSNLRLIDTMQEKAKNAWPTDAEQIYFTRNWQNLYQTRLENMPINDSWSETATL
LQQLSNKIVQQERNRGSFTLSYLKTAIYDIQKQHNKVEPIEEKLRQLAVQIETGQPISPATLNNIDNKIN
GLLARYYDLQKQAEQQGLKPGSYSSFGLDHE
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c811437-810082 Proteus mirabilis HI4320 chromosome, complete genome
ATGTTGAGTGCGATGAAATCAGAAAGTTTAGTGATTAAAATTGGGGGATCTCCACTTGATACCCCTGAAT
TTATTGCCCTGAAAACCGAATTTAATAAATTGAGCCACCCTGCTCGACCAGAAATAAGTTGGACACTTAT
TGAGTCACTTTGCTTATCCCTATTTAAAAATCATGGTATCGACCTACAAAGCGGTGCTTACTATACCATT
GCAAGATTACAACAGCATGGTTTAAGCGGTTTTACTGAAGGATGTGAGTTATTAGCAAATGTTATTGTGA
CTTATTGGGATAGCCTGTGGCCGGAAAAGCCAAATCAACGTACAGAGGTATTAAACTGGTTTAATACCAA
AGCCAGCGCTTTATTAAGACAACAATCCTATCAAGCAAAAGATCTACGATTAATCTATCGTTCAGAGCGC
GCGTTACAGTTAATAATCGATAAACTGGCTAAAACAACTTGGGAAAAACTGCCTAAAATTGAAAACTTAC
TGTGGTTTTTCCAAAACTTAGCCAAACAAATTGAAAAGCAAGAAAAACAGACGCAACAAGATAGTGCCGA
ACCCGTTAGCGTACCGCCATTAGTCTGTATTCAACAACCGTCGAAAACAACGGACAAAGCAGCCCCCACT
TTTGTGATTGAAACACCTCAACCCGCCTCTTCTTTCACTGTAGTAGCAAAAAAAATGAGTGCGACCCGAG
GTTTTATATGGGGCTGTGTGCTCAGTTGCATACTGTTTTTAGCTATCGGATTTGGTGTACATCTCTATTT
AAAACAAGAGATGAATGCGATTACTTCAATACCTGAAGGTGCGGCTGCCAAATGGTTGTTTAAACCACAG
TTAAATAGCTACGAGTATCATTTAGCATTATTAGAAAAACGTTCTCCTCTTTCTAATTTACGGCTAATTG
ATACGATGCAAGAAAAAGCCAAAAACGCTTGGCCTACAGATGCAGAGCAAATTTATTTTACACGTAATTG
GCAAAATCTTTATCAAACGCGCTTAGAGAATATGCCAATTAATGATAGCTGGTCTGAAACCGCGACATTA
TTACAACAACTTTCTAATAAAATAGTTCAGCAAGAACGAAATAGAGGCAGTTTTACACTCTCTTATCTAA
AAACGGCAATTTATGATATTCAAAAACAGCACAATAAAGTTGAGCCAATCGAAGAAAAACTGCGACAACT
CGCTGTACAAATTGAAACAGGGCAACCTATTTCTCCTGCAACTCTTAATAATATTGATAATAAAATTAAT
GGGTTATTAGCTCGTTATTATGATTTACAAAAACAAGCTGAACAACAAGGTTTAAAACCCGGCTCATATT
CATCTTTTGGATTAGATCATGAGTGA