SecReT6
Protein ID: 197284631
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0737
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]815026..816489 [-]
Producthypothetical protein
NoteTssA
UniProt IDB4ET49
KEGG IDpmr:PMI0737
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-14, Aligned region: 52..111
ImpA-rel_N [PF06812], Evalue: 1.80E-14, Aligned region: 152..164
Protein Sequence: 487 a.a.     [Download]
>gi|197284631|ref|YP_002150503.1| hypothetical protein PMI0737 [Proteus mirabilis HI4320]
MMNNTSYAWKQQLLTALDEQQVSSAVNDNDADWEYIDSEMIKFGSLSHGQLDIKEIQRRCLHLFETQTKD
FRILVHLLRTLQHAGEPKELVLAAQILTDFNRQYWQSCYPTNMKLKSRLANQVLKRFETASESFCHAANS
AMRDDILGSFAFLAQFWHEQSPALAEQIDDLSRDYNRIENNDAPIIVASPVEKEEKVQTPPVSESIETPT
KNSLTPTINVNHQDERQWKQTLLQVADVICQQAPESSVGYRIRRYAIWHAITVLPQANAQGKTPLAPVSI
DRVMDYKAQLTQASITLLNNIEQSLSLSPYWLEGHMLAAQVAAKLGYGEVESGIIEELRIFLARLPELVN
LHFSDMTPFFPESVQQWLEQYNQTENGQLPPSNTNTAILEQEVLQCYEQQGLEAALKLIELNLASRSEPR
DRFYGQLLSAQLFELSGMDYMATQLYQQLNTSASHYSLADWEPNLIRQLMQKIDKKTEITMTMDRDQ
 
Nucleotide Sequence: 1464 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c816489-815026 Proteus mirabilis HI4320 chromosome, complete genome
ATGATGAACAATACTTCTTATGCATGGAAACAACAGCTACTGACAGCACTTGATGAACAGCAAGTCAGTA
GTGCTGTCAATGATAATGATGCCGACTGGGAATATATTGACAGTGAAATGATAAAGTTCGGCTCACTTAG
TCATGGTCAATTAGATATTAAAGAGATCCAGCGTCGCTGTTTACACCTATTTGAAACGCAGACTAAAGAT
TTTCGGATCTTAGTCCATTTATTACGTACTTTACAGCATGCTGGAGAGCCAAAAGAATTAGTATTGGCAG
CACAGATCCTAACTGATTTTAATCGTCAATATTGGCAAAGTTGCTACCCAACCAATATGAAATTGAAATC
ACGTTTAGCCAATCAAGTTTTGAAACGTTTTGAAACAGCGAGTGAGAGTTTTTGTCATGCAGCCAACAGC
GCGATGCGTGATGATATTCTAGGCTCGTTCGCCTTTCTAGCGCAATTTTGGCATGAACAAAGCCCGGCAC
TTGCAGAACAAATTGATGATTTAAGCAGAGATTATAATCGTATTGAAAATAACGATGCGCCGATTATTGT
TGCTTCACCTGTCGAGAAAGAAGAAAAAGTACAGACTCCGCCGGTTAGCGAGTCTATAGAAACACCGACA
AAAAATAGCTTAACACCAACTATTAACGTTAACCATCAAGATGAAAGACAATGGAAACAAACATTACTTC
AAGTAGCTGATGTTATCTGCCAACAAGCCCCTGAAAGTTCAGTAGGATATCGTATACGGCGTTATGCAAT
TTGGCACGCTATTACGGTCTTACCTCAAGCTAATGCTCAAGGTAAAACGCCTTTAGCCCCCGTATCAATT
GACCGTGTAATGGATTACAAAGCTCAACTGACTCAAGCGTCCATTACGCTATTAAACAATATTGAACAGA
GTCTCTCACTCTCTCCTTACTGGTTAGAAGGCCATATGTTAGCTGCACAAGTAGCAGCTAAATTAGGTTA
TGGGGAAGTAGAAAGTGGCATTATTGAAGAGTTACGTATTTTTTTAGCGCGTCTTCCTGAACTTGTTAAC
TTGCACTTTTCGGATATGACACCCTTCTTTCCTGAAAGTGTACAACAGTGGTTAGAGCAATATAACCAAA
CTGAAAACGGTCAATTGCCACCATCGAATACGAATACTGCAATCCTAGAGCAAGAGGTCTTGCAATGTTA
TGAGCAACAAGGTCTTGAAGCAGCCCTGAAGCTTATTGAATTAAACCTTGCTAGCAGATCAGAGCCTAGA
GATAGATTTTATGGACAATTATTGTCTGCACAACTATTTGAATTGTCAGGTATGGATTATATGGCTACAC
AGTTATACCAACAACTTAATACCTCTGCCTCACATTATTCACTTGCAGATTGGGAACCCAACTTAATACG
ACAACTCATGCAAAAAATAGACAAAAAGACAGAAATAACAATGACTATGGATAGGGATCAATAA