SecReT6
Protein ID: 197284634
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0740
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]817939..820650 [-]
ProductATPase
NoteTssH
UniProt IDB4ET52
KEGG IDpmr:PMI0740
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.20E-38, Aligned region: 278..325
AAA_2 [PF07724], Evalue: 3.20E-38, Aligned region: 511..534
AAA_2 [PF07724], Evalue: 3.20E-38, Aligned region: 641..802
AAA [PF00004], Evalue: 1.20E-19, Aligned region: 221..332
AAA [PF00004], Evalue: 1.20E-19, Aligned region: 647..772
AAA_5 [PF07728], Evalue: 7.20E-13, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 7.20E-13, Aligned region: 365..385
AAA_5 [PF07728], Evalue: 7.20E-13, Aligned region: 646..766
ClpB_D2-small [PF10431], Evalue: 1.50E-11, Aligned region: 40..52
ClpB_D2-small [PF10431], Evalue: 1.50E-11, Aligned region: 552..576
ClpB_D2-small [PF10431], Evalue: 1.50E-11, Aligned region: 809..882
AAA_16 [PF13191], Evalue: 6.10E-09, Aligned region: 7..50
AAA_16 [PF13191], Evalue: 6.10E-09, Aligned region: 197..237
AAA_16 [PF13191], Evalue: 6.10E-09, Aligned region: 263..298
AAA_16 [PF13191], Evalue: 6.10E-09, Aligned region: 486..558
AAA_16 [PF13191], Evalue: 6.10E-09, Aligned region: 621..667
AAA_16 [PF13191], Evalue: 6.10E-09, Aligned region: 712..739
AAA_16 [PF13191], Evalue: 6.10E-09, Aligned region: 804..857
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 219..305
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 645..664
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 707..740
AAA_25 [PF13481], Evalue: 5.70E-06, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 5.70E-06, Aligned region: 549..572
AAA_25 [PF13481], Evalue: 5.70E-06, Aligned region: 641..675
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 640..666
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 135..183
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 220..238
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 544..569
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 645..686
NACHT [PF05729], Evalue: 0.00023, Aligned region: 220..248
NACHT [PF05729], Evalue: 0.00023, Aligned region: 647..674
NACHT [PF05729], Evalue: 0.00023, Aligned region: 851..876
DUF258 [PF03193], Evalue: 0.00032, Aligned region: 185..237
DUF258 [PF03193], Evalue: 0.00032, Aligned region: 647..663
AAA_29 [PF13555], Evalue: 0.00041, Aligned region: 213..237
AAA_29 [PF13555], Evalue: 0.00041, Aligned region: 644..671
AAA_17 [PF13207], Evalue: 0.001, Aligned region: 220..262
AAA_17 [PF13207], Evalue: 0.001, Aligned region: 647..681
IstB_IS21 [PF01695], Evalue: 0.0019, Aligned region: 214..242
IstB_IS21 [PF01695], Evalue: 0.0019, Aligned region: 646..658
Arch_ATPase [PF01637], Evalue: 0.0077, Aligned region: 200..234
Arch_ATPase [PF01637], Evalue: 0.0077, Aligned region: 274..310
Arch_ATPase [PF01637], Evalue: 0.0077, Aligned region: 647..667
Arch_ATPase [PF01637], Evalue: 0.0077, Aligned region: 713..728
AAA_10 [PF12846], Evalue: 0.0092, Aligned region: 218..239
AAA_10 [PF12846], Evalue: 0.0092, Aligned region: 289..304
AAA_10 [PF12846], Evalue: 0.0092, Aligned region: 467..556
AAA_10 [PF12846], Evalue: 0.0092, Aligned region: 646..670
Sigma54_activat [PF00158], Evalue: 0.0098, Aligned region: 220..233
Sigma54_activat [PF00158], Evalue: 0.0098, Aligned region: 646..744
Protein Sequence: 903 a.a.     [Download]
>gi|197284634|ref|YP_002150506.1| ATPase [Proteus mirabilis HI4320]
MIQIDLSTLVNRLHPIAKHALESAAAYCVSHQQPEITIAQFLQKLIETPLTDIRMISQKSALDINALSEL
LDIDIPPHQVITQSYPSFSPLLVEWMKDSWLLASTELNHSELRSGALFLTLLQMPLRYLAKPVADMLAQI
NRDQLKLNFDQWTEGSAESPFNEKTVSEKGNLAADSLLAKFTHNMTEQARNGELDPVLCRDNEIDLMIDI
LCRRRKNNPVVVGEPGVGKSALIEGLALRIIAGDIPDKLRGCELLTLDLGALQAGAAVKGEFEKRFKGIM
QEVTQSPHPIILFIDEAHTLIGAGNQQGGLDVSNLLKPALARGELRTIAATTWSEYKKYFEKDAALARRF
QLVQVKEPSSAEAIIIMRGLRSIYEKSHHVFIDDEALRASAELSERYISGRQLPDKAIDVLDTACARAAI
NLSSPPKALSSLKTELHQINMEMDVLQREHYLGLDDHSERLETLASQASAIEQQATDLQQAWEQQKELVS
QIITLRATLLNNATEATNDDVANDVANNEVVSDIRTYSEAEDAEDNDEKIAAQPPCSSEELKQQLQQLDK
QLAQLHDTHLLVSPHVDKKQIAAVIAEWTGVPLNRLSQDALSIVTELPTYLEESIKGQSLAIQCLHKHLL
TARADLRRPGRPLGAFLLAGPSGVGKTETVIQIAQLMFGGTQYLTTINMSEFQEKHTVSRLIGSPPGYVG
YGEGGILTEAIRKRPYSVVLLDEVEKAHPDVLNLFYQAFDKGEIADGEGRVIDCKNIAFFLTSNLGDHVI
TAYADKPDELEDALYPELTTFFKPALLARMEVIPYLPLPAEVLRQIVDGKLARLINLLKQRFNAEINVEE
SVATEILRRASRAENGARILESIIDGALLPPLSLLLLQYSARNEAISHIRLATENDEFIAEVN
 
Nucleotide Sequence: 2712 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c820650-817939 Proteus mirabilis HI4320 chromosome, complete genome
ATGATCCAAATTGATCTCTCTACTCTCGTTAATCGATTACACCCAATAGCTAAGCATGCCTTAGAAAGTG
CAGCCGCTTACTGTGTAAGCCACCAGCAACCTGAAATTACGATTGCTCAGTTTCTACAAAAACTGATAGA
AACGCCATTAACTGACATTCGTATGATCAGTCAAAAAAGCGCATTAGATATTAATGCGTTATCAGAGTTA
TTAGATATCGACATTCCGCCACATCAAGTTATTACACAAAGTTATCCTAGTTTTTCACCCTTATTAGTCG
AATGGATGAAAGATAGCTGGCTATTAGCGTCAACTGAGCTAAATCACAGTGAACTTCGCTCTGGTGCATT
GTTTTTAACTTTACTACAAATGCCTTTGCGTTATCTTGCGAAACCTGTTGCCGATATGCTTGCGCAGATT
AACCGCGACCAATTAAAACTCAATTTTGATCAATGGACTGAAGGCTCTGCTGAATCGCCTTTTAACGAAA
AAACAGTATCAGAAAAAGGTAACCTTGCCGCTGATTCATTGTTAGCGAAATTTACTCATAACATGACTGA
ACAAGCGCGAAATGGTGAGTTAGATCCGGTCTTATGTCGCGATAATGAAATCGACTTAATGATTGATATT
CTGTGCCGTCGCCGTAAAAACAATCCTGTAGTAGTCGGAGAGCCCGGTGTGGGTAAAAGTGCGTTAATTG
AAGGACTAGCACTACGTATTATTGCCGGAGATATTCCTGATAAATTAAGAGGTTGTGAACTTCTTACTCT
TGATTTAGGCGCATTACAAGCAGGTGCTGCAGTCAAAGGCGAATTTGAAAAACGCTTTAAAGGCATTATG
CAAGAAGTCACTCAATCTCCTCACCCTATCATTCTATTTATTGATGAAGCACACACCCTCATTGGTGCAG
GTAACCAGCAAGGTGGCTTAGATGTTTCTAATTTATTAAAACCGGCTTTGGCGCGTGGAGAACTACGAAC
TATCGCAGCAACGACTTGGAGCGAATACAAAAAATATTTTGAAAAAGATGCCGCGTTAGCGCGCCGTTTC
CAATTAGTGCAAGTCAAAGAGCCATCATCTGCAGAAGCCATTATCATTATGCGTGGCTTACGTAGTATCT
ATGAAAAATCCCACCATGTCTTTATTGATGATGAAGCACTACGAGCCAGTGCTGAATTAAGTGAACGTTA
TATCTCTGGACGTCAATTACCAGACAAAGCCATTGATGTATTAGATACAGCCTGTGCAAGAGCCGCGATT
AATCTATCTTCGCCACCAAAGGCATTATCCTCTTTGAAAACAGAACTCCACCAAATCAATATGGAAATGG
ATGTATTACAAAGAGAACACTATTTAGGTTTAGATGATCATTCTGAGCGTCTTGAAACGTTAGCCTCACA
AGCAAGTGCTATTGAGCAACAAGCAACTGATTTACAGCAAGCATGGGAGCAACAAAAAGAGCTTGTATCT
CAAATTATTACCTTACGAGCAACATTACTTAATAATGCTACCGAAGCGACTAATGACGATGTCGCAAATG
ATGTTGCAAATAATGAAGTGGTAAGTGATATAAGAACTTATAGTGAAGCAGAAGATGCTGAAGATAATGA
TGAAAAAATAGCAGCACAGCCCCCCTGCTCATCTGAAGAATTAAAGCAACAGTTACAACAATTAGATAAA
CAACTTGCTCAGTTACACGACACGCATTTACTGGTTTCGCCTCACGTCGATAAAAAACAAATTGCGGCGG
TAATTGCTGAATGGACCGGAGTACCATTAAATCGATTATCACAAGATGCATTATCAATTGTCACTGAGTT
GCCTACCTACTTGGAAGAGAGTATCAAAGGCCAATCATTAGCCATTCAATGTTTACACAAACATTTACTC
ACAGCGCGGGCTGATTTACGTCGACCGGGTCGACCGCTGGGGGCGTTCTTATTAGCAGGTCCTAGTGGCG
TGGGTAAAACAGAAACGGTTATCCAAATTGCCCAATTAATGTTCGGTGGCACACAATATCTCACGACTAT
TAATATGTCTGAGTTTCAAGAAAAACATACTGTTTCTCGCCTTATTGGTTCACCTCCCGGTTATGTGGGA
TATGGTGAAGGAGGGATCTTAACAGAAGCTATTCGTAAAAGACCTTACTCAGTTGTTTTACTCGACGAAG
TAGAGAAAGCGCATCCTGATGTGCTAAATCTATTTTATCAAGCTTTTGATAAAGGAGAGATAGCCGATGG
AGAAGGACGAGTCATTGATTGTAAAAATATCGCATTTTTCCTCACCTCTAATTTAGGTGACCATGTCATT
ACTGCTTACGCGGATAAACCGGACGAACTAGAAGATGCACTCTACCCTGAATTAACAACTTTCTTTAAAC
CAGCATTACTTGCTCGAATGGAAGTGATCCCTTATTTACCGTTGCCTGCAGAGGTTTTACGACAAATTGT
TGATGGCAAATTAGCTCGTCTTATTAACCTGTTAAAACAGCGTTTCAACGCAGAAATCAATGTAGAAGAG
AGTGTTGCTACGGAAATTTTACGCAGAGCTTCTCGTGCTGAAAATGGTGCGCGTATTTTGGAATCTATTA
TTGATGGTGCGTTATTGCCGCCTCTTTCTTTATTACTTCTACAATATAGTGCACGTAATGAAGCTATCTC
TCATATCCGCTTAGCGACTGAAAATGATGAGTTTATTGCGGAGGTTAATTAA