SecReT6
Protein ID: 197284635
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0741
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]820659..821414 [-]
Producthypothetical protein
NoteTssL
UniProt IDB4ET53
KEGG IDpmr:PMI0741
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.10E-61, Aligned region: 30..235
Protein Sequence: 251 a.a.     [Download]
>gi|197284635|ref|YP_002150507.1| hypothetical protein PMI0741 [Proteus mirabilis HI4320]
MTDDILLNHDDEERITKKNYQLPLRGNNINPMIDAATPLLGMVLRMKAMSETPLSEKLYQQVVMDITSIE
QQLQIQGYEPGAIVSFRYVLCTFIDETALGLGWDQDNGWVKQSLLVHFHNESWGGEKVFVLIERLLGEPK
RYLDLIEFIYLCLCLGYRGRYKVSAGQNDEFNHLLRRLQKQIQQLRGNAKPIVLFEKGDNQQSRYRLGKR
LGARYILIGTAVFALIIYSIYSSRLNYQTLSIVEQLNTLLG
 
Nucleotide Sequence: 756 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c821414-820659 Proteus mirabilis HI4320 chromosome, complete genome
ATGACTGATGATATTTTACTGAATCATGATGATGAAGAGCGCATTACAAAGAAAAATTACCAACTGCCGC
TAAGAGGAAACAACATCAATCCAATGATAGATGCTGCTACACCTTTATTAGGCATGGTATTGCGCATGAA
AGCGATGTCTGAAACCCCACTTTCAGAAAAGCTGTACCAACAAGTTGTCATGGATATTACCTCTATTGAG
CAACAATTACAGATCCAAGGTTACGAGCCAGGTGCCATTGTTTCATTTCGTTATGTGCTATGTACTTTTA
TTGATGAAACCGCCCTTGGATTAGGCTGGGATCAAGATAATGGTTGGGTAAAACAATCATTACTGGTTCA
TTTTCATAATGAATCATGGGGTGGTGAAAAAGTCTTTGTCTTAATTGAAAGATTATTAGGTGAACCTAAG
CGTTACCTCGATCTGATTGAATTTATCTACCTTTGTTTATGCCTAGGATACCGCGGGCGCTACAAAGTCT
CTGCGGGACAAAATGATGAATTTAATCATTTATTAAGACGCTTACAAAAACAGATCCAACAGCTAAGAGG
TAACGCTAAGCCAATAGTTCTATTTGAAAAAGGTGATAACCAACAAAGCCGTTATCGTTTAGGTAAGCGT
TTAGGGGCTCGCTATATTCTCATAGGTACAGCGGTATTCGCGTTGATTATTTATAGCATTTATTCATCCA
GACTGAATTATCAAACACTCAGTATTGTGGAACAACTTAATACTTTACTTGGCTAG