SecReT6
Protein ID: 197284636
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0742
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]821407..822765 [-]
Producthypothetical protein
NoteTssK
UniProt IDB4ET54
KEGG IDpmr:PMI0742
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.30E-148, Aligned region: 19..446
Protein Sequence: 452 a.a.     [Download]
>gi|197284636|ref|YP_002150508.1| hypothetical protein PMI0742 [Proteus mirabilis HI4320]
MSTKNRVIWREGLFIKPQHFQQQQRHQDYMTVSILNNFFSHFWGFSTLKLSDDLYALGRIGIKEASGVMP
DGTIFSIPNQDLLPQPIDITNITDSDSSIIYLAFPLMNENVSEISTEHNGSRLLSRYSESTENIRDLHTE
NGDISAIHVAQLTPILKQGKHGLDAYVALPICRIRERNANGNLTLDNDYIPSLLNIRASTLLSQFLTELE
GTLYERGKQIASRIGAPGQQGVADVAEFMMLQVLNRTYPLYSHYAQEPVIHPEKLFRDLLELCGELQTFT
NTSRLPENIAKYQHAKLTESYIPLIASIREALSVVLTPRAIPIPLQVQEHGIRVATIHDKQLLQRAEFII
AVKSQMPQEQLRRQFPQQTKVTTINNIRSLVSVQIPGVPLSPLSAAPRQLPYHSGYNYFHFDQQGNEWKG
IQQDGNIAFHVSGNFPDLDIQLWAIRDGALYD
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c822765-821407 Proteus mirabilis HI4320 chromosome, complete genome
ATGTCAACTAAAAATAGAGTGATCTGGCGTGAAGGGCTATTTATCAAACCTCAACATTTTCAACAACAAC
AACGTCATCAAGATTATATGACGGTGAGTATTTTAAATAACTTTTTTTCACACTTTTGGGGATTTAGTAC
CTTAAAATTGAGTGACGATTTATATGCTTTAGGTCGTATTGGTATTAAAGAAGCTTCTGGTGTTATGCCA
GACGGCACCATTTTCTCTATACCAAACCAAGATTTACTACCACAGCCTATTGATATAACGAATATTACTG
ATAGTGACAGCAGTATTATTTATCTAGCTTTTCCTTTAATGAACGAGAATGTCAGTGAAATTTCCACTGA
ACATAACGGTAGTCGTTTACTTTCTCGCTACAGCGAAAGCACCGAAAATATTCGTGATTTACATACTGAA
AATGGTGATATCAGTGCTATTCATGTTGCACAGCTCACACCAATACTCAAACAAGGTAAACATGGTTTAG
ATGCCTATGTTGCTTTACCTATCTGTCGTATTAGAGAGCGTAATGCTAATGGTAATTTAACGCTAGATAA
TGATTATATTCCCAGCCTATTAAATATCCGTGCCTCAACATTATTGAGCCAATTTCTCACCGAGCTTGAA
GGAACGCTATATGAAAGAGGAAAACAAATTGCCTCTCGCATTGGTGCCCCAGGTCAGCAAGGTGTTGCGG
ATGTGGCAGAATTTATGATGTTACAAGTGCTTAATCGCACTTATCCACTCTATTCGCATTATGCTCAAGA
GCCGGTGATCCATCCTGAAAAACTATTTCGAGATTTATTAGAGCTTTGTGGTGAACTACAAACATTCACG
AATACTTCACGTTTACCTGAAAATATTGCCAAATATCAACATGCTAAATTAACAGAAAGTTATATTCCAT
TAATAGCCAGTATCCGCGAAGCACTCAGTGTTGTCTTAACACCAAGAGCGATCCCAATCCCGCTACAAGT
TCAAGAGCATGGTATTCGTGTAGCAACCATTCATGACAAACAACTGCTACAACGAGCTGAATTTATTATT
GCGGTGAAATCACAAATGCCGCAAGAGCAACTACGTCGCCAATTCCCACAACAAACTAAGGTGACAACAA
TCAATAACATTCGCAGCTTGGTTAGTGTGCAAATACCGGGTGTTCCTTTATCACCACTTTCGGCTGCACC
AAGACAATTACCTTATCACTCGGGATATAACTATTTCCATTTTGATCAACAAGGCAATGAATGGAAAGGG
ATCCAGCAGGATGGCAACATCGCATTCCACGTTTCAGGAAACTTCCCCGATCTCGATATTCAGTTATGGG
CAATAAGAGATGGAGCACTCTATGACTGA