SecReT6
Protein ID: 197284637
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0743
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]822767..823318 [-]
Productlipoprotein
NoteTssJ
UniProt IDB4ET55
KEGG IDpmr:PMI0743
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-36, Aligned region: 16..175
Protein Sequence: 183 a.a.     [Download]
>gi|197284637|ref|YP_002150509.1| lipoprotein [Proteus mirabilis HI4320]
MQLRTFSILLLFSSFLILSGCSKPFEAAGKMGKILLDPSTPVGQPKDQPSTVALTILAEPYINPNQEGEA
APINIQVVYLNEDSVFGSVDHDQIDAKEGDLEKVLKKNYIDHQDYTILPGQYKPFPTMTLDPSNRYIGII
AYYSDPDKAEWKKIVKARGKGRHYFLLVHIRENEIEFRQEEDD
 
Nucleotide Sequence: 552 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c823318-822767 Proteus mirabilis HI4320 chromosome, complete genome
ATGCAGCTTAGAACTTTCTCAATATTACTGTTATTTAGCTCTTTTTTAATATTGAGTGGATGTAGTAAAC
CTTTTGAAGCCGCGGGTAAAATGGGGAAAATCTTATTAGATCCCTCAACTCCTGTTGGGCAACCGAAAGA
TCAGCCCTCTACCGTTGCATTAACCATCCTTGCGGAGCCCTATATTAATCCTAATCAGGAAGGTGAAGCT
GCGCCGATAAATATCCAAGTTGTTTATCTTAACGAAGATTCAGTATTTGGCTCTGTTGATCATGATCAGA
TAGATGCAAAAGAGGGTGACTTAGAGAAAGTTCTAAAGAAAAATTATATTGACCATCAAGACTACACCAT
TTTACCTGGCCAATATAAACCCTTCCCTACTATGACGTTAGACCCATCTAACCGTTACATTGGCATTATT
GCCTATTACTCAGATCCTGATAAAGCAGAATGGAAGAAAATAGTCAAAGCGCGTGGTAAAGGACGCCACT
ACTTCCTATTAGTGCACATTAGGGAAAATGAAATCGAATTTAGACAAGAAGAGGATGATTAA