SecReT6
Protein ID: 197284638
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0744
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]823320..824588 [-]
Productphosphopeptide-binding protein
NoteFha
UniProt IDB4ET56
KEGG IDpmr:PMI0744
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.00027, Aligned region: 35..100
Protein Sequence: 422 a.a.     [Download]
>gi|197284638|ref|YP_002150510.1| phosphopeptide-binding protein [Proteus mirabilis HI4320]
MDKYQPTISFSIKNSEQLESGYLPNATLTQSSGQIGSGNQCDWKIQDNEGAIADRQCTVFWKDQHFCLKV
NSGPVYINNAIIPLHLDAVRLTQGDQIKVGKLVIATNISLTGEPVQNMMAMTPQSIIAKDHNPLDSLFDV
DTTVKNERKEPPFVPTVQGALTTDPLQALENENLSLISKNTQATSDDPLLSDPHSYSSAFPTSDNQENTM
VQEFIDLPKITPNENEHMTDVDHVAVNPLMKGLGIHLNLTNTQHANDFLVELGKTVKAAIEGLLILQQQQ
ESLQDKQLRPIEDNPLRLNSGYEETMKLMFTDERSPVHLSAPAAVTESLHNIQLHYQANQEAISTALSTM
LAAFSPEHLLNRFSQYRRASDNTPMNDGWAWEMYNNYYKELSSSRQQGFEKLFYEVYSHAYDRALRKGIE
EA
 
Nucleotide Sequence: 1269 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c824588-823320 Proteus mirabilis HI4320 chromosome, complete genome
ATGGATAAATATCAGCCAACAATTTCTTTTAGCATCAAAAATAGTGAACAGCTAGAAAGTGGTTATCTGC
CAAATGCGACTTTAACTCAAAGTAGCGGACAGATTGGTAGTGGCAATCAATGTGACTGGAAAATCCAAGA
TAATGAAGGTGCTATTGCCGATCGGCAATGTACGGTGTTTTGGAAAGATCAACACTTTTGCTTAAAAGTA
AATTCAGGTCCTGTTTACATTAATAATGCGATTATTCCATTGCATCTTGATGCCGTTAGACTGACCCAAG
GTGATCAGATAAAAGTGGGTAAATTAGTTATTGCCACCAATATTAGTCTTACCGGAGAGCCGGTACAAAA
TATGATGGCGATGACGCCTCAGTCTATTATCGCAAAAGATCATAATCCGCTAGATTCATTATTTGATGTT
GATACAACAGTCAAAAATGAGCGGAAAGAGCCTCCGTTTGTACCAACCGTTCAGGGTGCATTAACAACAG
ATCCACTACAGGCTTTAGAAAACGAAAATCTAAGCTTAATTTCTAAAAACACACAAGCTACTTCAGACGA
TCCTTTATTGAGTGACCCCCACTCGTATTCATCTGCCTTTCCGACATCAGATAATCAAGAGAATACTATG
GTCCAAGAATTTATTGATTTACCTAAAATCACACCTAATGAAAACGAACATATGACCGATGTCGATCATG
TGGCGGTTAACCCTCTGATGAAGGGATTAGGTATCCACCTTAATTTAACAAATACACAGCATGCTAATGA
TTTTCTTGTTGAACTGGGTAAAACCGTCAAAGCGGCTATTGAAGGTTTACTGATTTTGCAACAACAACAA
GAAAGCTTACAAGATAAGCAATTACGCCCAATTGAAGATAATCCTCTACGTCTTAATAGTGGCTATGAAG
AGACAATGAAGTTGATGTTTACCGATGAACGTAGCCCTGTACATCTTTCAGCACCTGCGGCAGTAACAGA
AAGCTTGCACAACATCCAATTGCATTATCAAGCGAATCAAGAAGCTATTTCAACCGCACTATCAACCATG
TTGGCAGCATTCTCTCCTGAACATTTATTAAACCGCTTTTCTCAGTATCGACGAGCTTCAGATAACACAC
CAATGAATGATGGCTGGGCTTGGGAAATGTACAACAACTATTACAAAGAACTCTCTTCATCTCGGCAACA
GGGTTTTGAAAAATTATTCTATGAAGTATACAGCCATGCTTATGACAGAGCGCTGAGAAAAGGAATAGAG
GAAGCTTAA