SecReT6
Protein ID: 197284639
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0745
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]824593..825630 [-]
Producthypothetical protein
NoteTssG
UniProt IDB4ET57
KEGG IDpmr:PMI0745
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-85, Aligned region: 24..332
Protein Sequence: 345 a.a.     [Download]
>gi|197284639|ref|YP_002150511.1| hypothetical protein PMI0745 [Proteus mirabilis HI4320]
MASTNQPAHTEVIDRWLEQAGSSVTEYNFYQLVELLNKIIHQDVNSMEDDSGILRFKSYSNIAFPTRDVI
SIEKNNVEQYELEVAFLGLQGSQSPLPGYYLDEFAWEDAQQIEGISAFLDIFNHRLIALLYRIWRKYRYY
ICFENEGQDSFSQYMFSLVGLGNGANRGRIKINHSKMLAYAGLLASPSRSSDVISSLISHCFDLENVKVI
GWETRRVPIPESQQNKLGTISHQSGQKSRPRMLLGENFSLGSHIYDCNGKCTIEISELSLERYMRFLPNG
SDFAPLVAFVSYIFHEQLAWDLRLSIAEKQAEGFRLGHQQHNQLGWQSFLGQPAKKPDVTITVLE
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c825630-824593 Proteus mirabilis HI4320 chromosome, complete genome
ATGGCCAGCACAAATCAACCAGCACATACTGAAGTAATCGATCGTTGGCTGGAACAAGCTGGCTCATCGG
TAACAGAGTATAATTTTTATCAACTCGTTGAATTGTTAAATAAAATAATTCATCAAGATGTCAACTCGAT
GGAGGATGACAGCGGTATTCTTCGCTTTAAATCTTATTCAAATATTGCATTTCCGACGCGAGATGTCATT
TCCATTGAAAAAAATAATGTCGAACAATATGAATTAGAAGTCGCTTTTTTAGGCTTACAAGGAAGTCAGT
CCCCCCTACCAGGCTATTATCTGGATGAGTTTGCTTGGGAAGATGCACAACAGATAGAAGGTATCTCCGC
TTTTCTCGATATCTTCAATCATCGTCTGATAGCGTTACTTTATCGGATCTGGCGCAAATATCGTTACTAC
ATTTGCTTTGAAAATGAAGGTCAGGATTCATTTTCACAATATATGTTTTCTCTCGTTGGATTAGGTAATG
GAGCTAATCGCGGTCGGATCAAAATCAACCATAGCAAAATGCTCGCTTATGCTGGTCTTTTGGCGAGTCC
AAGTCGCTCTTCTGATGTGATTAGTAGTCTTATATCTCACTGTTTCGACTTAGAAAATGTAAAAGTAATT
GGTTGGGAGACACGCCGTGTTCCTATTCCTGAATCACAACAAAACAAGTTAGGTACGATTTCTCATCAAT
CCGGACAAAAATCTCGCCCACGAATGTTATTAGGGGAAAATTTTAGTCTGGGCTCACACATATATGACTG
CAATGGAAAATGCACCATCGAAATCAGTGAATTAAGTTTAGAACGCTATATGCGTTTTTTACCTAACGGC
AGTGATTTCGCACCATTAGTTGCCTTTGTTTCTTACATTTTTCATGAGCAATTAGCTTGGGATTTACGTC
TTAGCATTGCTGAAAAGCAAGCCGAAGGGTTCCGTTTGGGTCACCAACAACACAACCAATTAGGCTGGCA
AAGCTTTTTAGGTCAACCCGCAAAGAAACCGGATGTCACCATTACGGTATTGGAATAA