SecReT6
Protein ID: 197284640
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0746
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]825594..827369 [-]
Producthypothetical protein
NoteTssF
UniProt IDB4ET58
KEGG IDpmr:PMI0746
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.00E-149, Aligned region: 5..590
Protein Sequence: 591 a.a.     [Download]
>gi|197284640|ref|YP_002150512.1| hypothetical protein PMI0746 [Proteus mirabilis HI4320]
MSSKSYFTNESEYLNELTEQVAKEKPQLVNLLSHNVKDPDTSRIMDGLSYLSGNLRQQIDRQFPELTNSL
ANMLWPNYARPVPSMTIVEYHPNYAQCQHATKISAGQPFSAAPLYVQSEETNHETLFQCRFSQSRDLWLM
PTKISNILQQTTAIEITFELATKQPLANIGLDKLCFYLNGAPFTTNQLYFLLSQHVQSASLVTDVHTLPL
THFSVTPVGFQKQDALLPYPKNSYDGYRILQEFFCFPEAFLFLDIHGLDDIPLAIEAEQFKLVINFDLEI
PDGVILYDDSIKLNCTPIVNLFPIDSEAINLTGKSEEYVLSPNYQLTECFDIFSINEVRGLRYPNDAKPY
PITYTAFESFYHQNHQTQNHGYYRLKISQNEQLYGYSHRLSFVRQQEPQLQQCEETVSVALNCTNRYIAS
QLSTRSIDLDSASMPYGALSAKNLFAPTLPLYPLLDKTLYWSELTNLSLNYQSLLNLDSLKKILQLYDLP
SVYNTQVARQSQKRLDALVDLHSEHIEHIYKGLPVRGLKTTLVVHQNAFLSEGSLFLFCTVIAQFFTLYT
SINMFHELEVINLDNKEVYRWPAQINQHILK
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c827369-825594 Proteus mirabilis HI4320 chromosome, complete genome
ATGTCATCAAAATCCTACTTTACCAATGAATCAGAATACTTAAATGAGCTGACTGAACAAGTTGCCAAAG
AAAAACCGCAACTTGTTAATTTGCTTTCGCACAATGTTAAAGATCCTGATACTTCGCGGATTATGGATGG
GCTATCTTATTTATCGGGTAATTTACGCCAGCAAATAGATAGACAATTTCCTGAATTAACTAATAGTTTA
GCCAATATGCTTTGGCCAAACTACGCACGCCCTGTGCCAAGCATGACGATTGTTGAATATCATCCTAATT
ATGCTCAGTGCCAACACGCAACAAAAATTTCAGCAGGACAACCCTTTAGTGCCGCTCCACTTTATGTGCA
AAGTGAGGAAACAAACCACGAGACGTTATTTCAATGTCGATTTAGTCAAAGTCGCGACCTCTGGTTAATG
CCGACAAAAATCAGTAACATTTTGCAGCAAACAACCGCCATTGAAATAACATTTGAGTTAGCAACAAAAC
AGCCACTTGCCAATATTGGCTTAGATAAATTGTGTTTTTACTTAAATGGTGCGCCATTTACTACAAATCA
GCTCTATTTTTTATTAAGCCAGCATGTGCAGAGTGCCTCTTTAGTCACAGATGTACATACGCTACCTCTT
ACTCACTTTTCAGTTACGCCTGTTGGTTTTCAAAAGCAGGATGCCTTACTTCCATACCCGAAAAATAGCT
ATGATGGCTATCGTATACTGCAAGAGTTTTTCTGTTTTCCTGAAGCCTTTCTCTTTCTAGATATTCATGG
TTTGGATGACATTCCTTTGGCTATCGAAGCAGAGCAATTCAAACTGGTGATCAATTTTGATCTAGAAATT
CCTGATGGCGTTATTCTTTACGACGACAGTATTAAACTTAATTGCACCCCTATTGTGAATTTATTTCCTA
TTGATAGTGAAGCAATAAATTTGACGGGGAAAAGTGAGGAGTATGTTTTAAGTCCTAATTACCAACTTAC
TGAATGTTTTGATATTTTTTCGATTAATGAGGTTAGAGGGTTACGTTATCCTAATGATGCTAAACCTTAT
CCGATCACCTATACAGCATTTGAAAGTTTTTATCATCAAAACCATCAGACTCAAAATCATGGCTATTACC
GTTTAAAGATAAGTCAAAATGAACAGTTATACGGCTATTCCCATCGACTTTCTTTTGTTCGTCAGCAAGA
GCCTCAGTTACAACAGTGTGAAGAAACCGTTTCTGTTGCACTCAACTGTACTAACCGCTATATCGCTTCC
CAGTTATCGACGCGTTCTATCGATTTAGATAGTGCATCAATGCCTTATGGGGCTTTATCTGCTAAGAATT
TATTCGCACCAACACTGCCTTTATATCCATTATTAGATAAAACATTATATTGGTCTGAATTAACTAATTT
ATCTTTAAATTATCAGTCTTTGCTCAATCTTGATTCATTAAAAAAAATATTACAACTCTATGATTTACCG
TCTGTTTATAACACACAGGTTGCAAGGCAATCACAAAAACGCCTAGATGCATTAGTTGATTTACATTCAG
AGCATATTGAGCATATCTACAAAGGCCTTCCTGTTCGCGGTCTGAAGACAACGTTAGTTGTTCATCAAAA
TGCGTTTCTTTCAGAAGGAAGTTTATTCCTATTTTGTACCGTTATCGCTCAATTTTTCACCTTATATACC
AGCATTAATATGTTTCATGAGTTGGAAGTTATTAACCTTGATAATAAGGAAGTTTATCGATGGCCAGCAC
AAATCAACCAGCACATACTGAAGTAA