SecReT6
Protein ID: 197284641
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0747
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]827377..827808 [-]
Producthypothetical protein
NoteTssE
UniProt IDB4ET59
KEGG IDpmr:PMI0747
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.00E-16, Aligned region: 32..125
Protein Sequence: 143 a.a.     [Download]
>gi|197284641|ref|YP_002150513.1| hypothetical protein PMI0747 [Proteus mirabilis HI4320]
MASNYGWQANAGASLFERIRGKNLGFSHRSRTNTLIESIKQNLNYILNARPDGCQGTPPLGIPDLNDATQ
STVDFKSHLEDSISSCIIAYEPRISKVVVKFLEEDADSLSLQFNINAFIDLENKQQLIEFNVYLDNNRRY
QLK
 
Nucleotide Sequence: 432 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c827808-827377 Proteus mirabilis HI4320 chromosome, complete genome
ATGGCATCCAATTATGGCTGGCAGGCTAATGCTGGCGCCAGCTTATTTGAACGGATCCGAGGGAAAAACT
TAGGTTTTTCCCATCGTTCGCGAACAAATACACTCATTGAATCAATAAAACAGAATTTAAATTACATCTT
AAATGCTAGACCTGATGGTTGCCAAGGAACGCCACCCTTAGGGATCCCTGATTTAAATGATGCGACTCAA
TCTACGGTTGATTTTAAATCTCACCTAGAAGATAGCATTAGTAGTTGCATTATTGCGTATGAACCACGGA
TCAGCAAAGTTGTAGTGAAATTTCTTGAAGAAGATGCAGATAGTTTATCTTTACAATTTAATATTAATGC
TTTTATTGATTTAGAAAATAAGCAGCAACTTATTGAATTTAATGTGTATTTAGATAATAACCGTAGATAT
CAGCTTAAATAG