SecReT6
Protein ID: 197284643
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0749
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]829313..829813 [-]
Producthypothetical protein
NoteTssB
UniProt IDB4ET61
KEGG IDpmr:PMI0749
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.40E-60, Aligned region: 8..160
Protein Sequence: 166 a.a.     [Download]
>gi|197284643|ref|YP_002150515.1| hypothetical protein PMI0749 [Proteus mirabilis HI4320]
MSKKNLGSVAPKERINIKYTPNTGGAQAEVELPLNMLIVGDMKGKTEETPIEDRKAISVNQNNFNSVMES
AGINLNINVRNTLEESSDSELNVNLDVKSLQDFSPDSIARQVPELNKLLELREALVALKGPLGNVPAFRK
RLQELLENQETREQLLKELDIAANQK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c829813-829313 Proteus mirabilis HI4320 chromosome, complete genome
ATGAGTAAGAAAAATCTCGGTAGTGTTGCCCCTAAAGAAAGGATTAATATTAAATATACGCCAAATACTG
GCGGAGCTCAGGCTGAAGTCGAACTTCCATTGAATATGTTGATTGTTGGGGATATGAAAGGTAAAACGGA
AGAGACCCCCATTGAAGATCGCAAAGCGATTTCAGTCAATCAAAACAACTTCAATTCTGTTATGGAAAGT
GCTGGCATTAATTTAAATATTAATGTTCGCAATACCTTAGAAGAAAGCAGTGATTCAGAGCTTAATGTTA
ATCTTGATGTGAAATCTTTACAGGATTTCTCTCCTGATAGTATCGCTCGCCAAGTGCCCGAATTAAATAA
ACTTCTCGAATTGCGTGAAGCTTTAGTTGCATTAAAAGGTCCTCTAGGCAATGTCCCAGCTTTTAGAAAG
CGTCTTCAAGAACTACTTGAAAATCAAGAAACTCGCGAACAGCTTCTAAAAGAGCTCGATATTGCTGCTA
ATCAAAAATAA