SecReT6
Protein ID: 197284645
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0751
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]832312..834462 [+]
ProductVgrG-like protein
NoteTssI
UniProt IDB4EVA4
KEGG IDpmr:PMI0751
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-51, Aligned region: 130..421
Phage_base_V [PF04717], Evalue: 1.40E-19, Aligned region: 463..551
Protein Sequence: 716 a.a.     [Download]
>gi|197284645|ref|YP_002150517.1| VgrG-like protein [Proteus mirabilis HI4320]
MLSKDPKSTPIDPASVLKDEAINQVKNRVQSKVNETLSTPTQKVAGMASAAASLTQSASASANRVTAHPL
IHGGGFTGGQTFAENQALQAAHGALLDALGMDSLESGLVFTCTIGGLPDDTFQVTEFNLTEGLSSLFSLS
ISAVSALPFIDFQRHLGLASSLTVKRDGVLIRKVNGILAGAVQGNTDGVKTWYHFDIRPEMWVMTLNQDS
RIFQHQSVPTILKTLLDEAHVKADCQFYREDLHPERLYTTQKRESAFDFWCRLAFEEGINFWFEEEQLFY
SDEHMGMTAGIHLTYNPQADTDISDSTAMTWQYGEYLCVDETIHKDNNFVRPSYPLSHENKIEQGGQHSV
FESYGRFQLDDEGRPLTQVRFEQLRNGSKVGQATTNCFALMPGKIFTLSQHPHQPMNDRWQVISVSHHGV
QPLADNSGGEGTQLSNSVSFIPGTQEWRPPYRYKPTADGDEMATVVGPPGEEIYVNEYGAVKVHFHWDRR
GSADHSASCWVRVAMGWSGNGYGFSAVPRIGTQVLVSYLNGDIDRPIITGCTYDGRNAPPIKFPENKTQT
TFRSQTHKGEGFNELRFEDAGGKQEVFLHAQKDMNTKVLNNRTTHVLADHFEVVEKNQMIKITQNQDEEV
GENKKLFVNKDYQQRVGANKTSIVKQNIKYVAGDSFEIVCGKSTLQMDKEGYIRIRGHEIIIETSGDQYI
KADGDITLKAKTILGN
 
Nucleotide Sequence: 2151 bp     [Download]
>gi|197283915|ref|NC_010554.1|:832312-834462 Proteus mirabilis HI4320 chromosome, complete genome
ATGCTTAGCAAAGATCCGAAATCAACGCCCATTGACCCGGCATCCGTTTTAAAAGATGAAGCCATCAATC
AAGTAAAAAATAGGGTGCAATCCAAAGTGAACGAAACGCTATCGACACCCACGCAAAAGGTGGCCGGGAT
GGCCTCAGCAGCGGCCTCGCTCACGCAATCAGCCAGCGCATCGGCCAATAGGGTGACGGCTCATCCCCTG
ATCCACGGTGGCGGTTTTACCGGTGGACAAACATTCGCTGAAAACCAAGCACTCCAAGCGGCCCATGGGG
CGTTACTTGATGCATTAGGCATGGACAGCCTCGAAAGTGGTTTGGTGTTCACTTGCACCATTGGTGGATT
GCCTGACGACACCTTTCAAGTCACCGAATTTAATCTTACCGAAGGATTATCCTCGCTATTTTCACTGTCC
ATCAGTGCGGTCAGTGCCTTACCCTTTATCGATTTTCAGCGCCATCTTGGCTTAGCCTCATCATTAACGG
TCAAACGTGATGGGGTGTTGATCCGCAAAGTCAACGGTATCTTAGCCGGGGCAGTACAAGGCAATACCGA
CGGAGTGAAAACGTGGTATCACTTCGATATTCGCCCTGAAATGTGGGTGATGACCCTCAATCAAGACAGC
CGTATTTTTCAACATCAATCGGTGCCGACCATCTTAAAAACCTTATTGGATGAGGCCCATGTTAAAGCGG
ATTGCCAATTCTACCGTGAAGATCTACACCCTGAACGTCTCTACACCACCCAAAAACGCGAATCGGCATT
TGATTTTTGGTGTCGACTGGCGTTTGAAGAGGGCATTAACTTCTGGTTTGAAGAAGAACAACTGTTTTAC
AGCGATGAACATATGGGGATGACGGCGGGTATTCACCTCACCTATAACCCGCAGGCCGACACCGATATCA
GCGATAGCACTGCCATGACTTGGCAATATGGCGAATATTTGTGTGTGGATGAAACTATCCATAAAGACAA
CAACTTTGTGCGTCCTTCTTATCCGTTGTCTCATGAAAACAAAATTGAGCAGGGGGGACAGCACAGTGTG
TTTGAAAGTTATGGTCGTTTTCAATTAGACGATGAAGGTCGACCTCTGACACAGGTGCGCTTTGAGCAAT
TACGTAACGGCAGCAAAGTGGGGCAAGCGACAACAAACTGTTTTGCGCTGATGCCCGGCAAAATCTTCAC
CTTATCTCAGCATCCCCATCAGCCGATGAATGATCGCTGGCAAGTGATCAGCGTCAGCCATCATGGTGTA
CAGCCACTGGCGGACAATAGCGGGGGCGAAGGCACACAACTGTCGAATAGCGTCTCCTTTATTCCGGGCA
CGCAAGAGTGGCGTCCCCCTTATCGTTATAAACCGACGGCGGACGGCGATGAAATGGCGACGGTGGTAGG
ACCACCGGGGGAAGAAATCTACGTCAATGAATATGGCGCCGTGAAAGTGCATTTTCATTGGGATCGTCGG
GGAAGTGCCGATCACAGTGCTTCATGCTGGGTGCGGGTTGCCATGGGTTGGAGTGGAAATGGTTATGGTT
TTTCTGCGGTACCGCGCATCGGCACACAAGTGCTGGTCAGTTACCTGAATGGGGATATCGACAGACCGAT
AATTACCGGTTGTACCTATGATGGTCGTAACGCACCACCGATTAAGTTCCCAGAGAATAAGACACAAACC
ACTTTCCGTAGCCAAACCCACAAAGGGGAAGGTTTTAATGAACTGCGTTTTGAAGATGCGGGCGGTAAGC
AAGAGGTGTTTCTTCATGCGCAGAAGGATATGAATACTAAAGTATTAAACAATAGAACAACGCATGTACT
TGCAGATCATTTTGAAGTAGTCGAAAAAAATCAAATGATCAAAATTACACAAAATCAAGATGAAGAAGTG
GGTGAAAATAAGAAGTTATTTGTTAATAAGGATTATCAGCAAAGAGTTGGCGCTAATAAAACATCTATAG
TTAAACAAAACATTAAATATGTTGCTGGGGATTCATTTGAAATTGTATGTGGTAAATCAACATTACAAAT
GGATAAAGAGGGTTATATTCGGATCCGAGGACATGAAATCATAATTGAAACATCTGGAGATCAATATATT
AAAGCCGATGGAGATATCACCCTTAAAGCCAAAACAATTTTAGGTAATTAA