SecReT6
Protein ID: 197336709
SecReT6 ID300
T6SS typei1
Gene symbolclpV_2
Locus tagVFMJ11_A0832
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]919176..921842 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDB5EUL3
KEGG IDvfm:VFMJ11_A0832
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.10E-45, Aligned region: 219..268
AAA_2 [PF07724], Evalue: 5.10E-45, Aligned region: 622..787
AAA [PF00004], Evalue: 1.20E-22, Aligned region: 220..348
AAA [PF00004], Evalue: 1.20E-22, Aligned region: 627..752
ClpB_D2-small [PF10431], Evalue: 1.90E-15, Aligned region: 793..868
AAA_16 [PF13191], Evalue: 5.80E-14, Aligned region: 195..236
AAA_16 [PF13191], Evalue: 5.80E-14, Aligned region: 262..296
AAA_16 [PF13191], Evalue: 5.80E-14, Aligned region: 406..492
AAA_16 [PF13191], Evalue: 5.80E-14, Aligned region: 602..650
AAA_16 [PF13191], Evalue: 5.80E-14, Aligned region: 691..720
AAA_16 [PF13191], Evalue: 5.80E-14, Aligned region: 830..863
AAA_5 [PF07728], Evalue: 2.10E-13, Aligned region: 220..238
AAA_5 [PF07728], Evalue: 2.10E-13, Aligned region: 293..348
AAA_5 [PF07728], Evalue: 2.10E-13, Aligned region: 626..747
AAA_22 [PF13401], Evalue: 5.20E-10, Aligned region: 218..314
AAA_22 [PF13401], Evalue: 5.20E-10, Aligned region: 624..739
Sigma54_activat [PF00158], Evalue: 1.40E-06, Aligned region: 215..233
Sigma54_activat [PF00158], Evalue: 1.40E-06, Aligned region: 626..747
AAA_17 [PF13207], Evalue: 2.50E-06, Aligned region: 220..283
AAA_17 [PF13207], Evalue: 2.50E-06, Aligned region: 625..649
AAA_17 [PF13207], Evalue: 2.50E-06, Aligned region: 809..875
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 219..242
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 274..313
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 617..658
Clp_N [PF02861], Evalue: 2.00E-05, Aligned region: 24..75
IstB_IS21 [PF01695], Evalue: 3.30E-05, Aligned region: 203..240
IstB_IS21 [PF01695], Evalue: 3.30E-05, Aligned region: 626..646
IstB_IS21 [PF01695], Evalue: 3.30E-05, Aligned region: 736..758
Zeta_toxin [PF06414], Evalue: 4.30E-05, Aligned region: 218..236
Zeta_toxin [PF06414], Evalue: 4.30E-05, Aligned region: 298..340
Zeta_toxin [PF06414], Evalue: 4.30E-05, Aligned region: 625..666
NACHT [PF05729], Evalue: 5.30E-05, Aligned region: 220..246
NACHT [PF05729], Evalue: 5.30E-05, Aligned region: 626..651
AAA_19 [PF13245], Evalue: 9.80E-05, Aligned region: 215..239
AAA_19 [PF13245], Evalue: 9.80E-05, Aligned region: 623..648
AAA_18 [PF13238], Evalue: 0.00062, Aligned region: 221..238
AAA_18 [PF13238], Evalue: 0.00062, Aligned region: 627..655
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 198..231
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 270..303
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 624..647
AAA_23 [PF13476], Evalue: 0.0024, Aligned region: 220..236
AAA_23 [PF13476], Evalue: 0.0024, Aligned region: 444..481
AAA_23 [PF13476], Evalue: 0.0024, Aligned region: 623..759
DUF258 [PF03193], Evalue: 0.0025, Aligned region: 137..178
DUF258 [PF03193], Evalue: 0.0025, Aligned region: 187..236
DUF258 [PF03193], Evalue: 0.0025, Aligned region: 624..647
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 220..239
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 627..648
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 728..745
AAA_10 [PF12846], Evalue: 0.0057, Aligned region: 27..81
AAA_10 [PF12846], Evalue: 0.0057, Aligned region: 218..232
AAA_10 [PF12846], Evalue: 0.0057, Aligned region: 286..301
AAA_10 [PF12846], Evalue: 0.0057, Aligned region: 360..452
AAA_10 [PF12846], Evalue: 0.0057, Aligned region: 625..656
AAA_33 [PF13671], Evalue: 0.0063, Aligned region: 219..235
AAA_33 [PF13671], Evalue: 0.0063, Aligned region: 625..646
Protein Sequence: 888 a.a.     [Download]
>gi|197336709|ref|YP_002158381.1| type VI secretion ATPase, ClpV1 family [Vibrio fischeri MJ11]
MININLSSLIQRLHPITKVALEDAAALAVSERASEVQIEHFLLSLLERPNSDFDQLLAHFECSENLLRQA
IKSTLENSHKSNGGKPVFSAMLIEWLQEAWLVSSLDLSETQIRSGALLLTLISNPLRYGQHGYSSLLENI
NPETLKRNFAELTSRSIESQVATSEQTHAREDGSALSKFTTDFTGKARKGEIDPVFCRDQEIRQIIDILA
RRRKNNPIAVGEPGVGKTAVVEGLALKIVQGEVPDCLKGVELYGLDMGLLQAGASVKGEFEKRLNAVLDE
VKNSPTPIILFIDEAHTLVGGGNQAGGSDAANLLKPALARGEVKTIAATTWSEYKKYFEKDPALARRFQL
VKLDEPSTEQAALIIRGLRAVYEKSHNVYVRDDAITAAATLSDRYISGRQLPDKAIDVLDTACARVNISL
NAIPAPIETLQQEIAALERELEALERDQLQQTGDRHALAAIPELKARMDEALEEQSILQHQWKKEQALIN
EMIELRAHLHDLTLGTPSNEDVDDEDNQDKPACSQFTEEETRQAIHTCNEQLEAARGNSPLVHFEVGPDE
ISHVISDWTGIPMGKMLQDEAETTLNLVSSLTESIKGQPYAIEALAEGLQTAKAGLVNPDAPTGVFLLVG
PSGVGKTETARAIADQMFGGERFMTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRQRPYSVVL
LDEVEKADPEVLNLFYQVFDKGTLNDGEGRTIDFKNTLIIMTSNLATHEIESLVQQSKDIDANIVAEAIR
PTLNSHFKPALLARMNVLPFLPLNDEAMTDIIIHKLNKVSKRLEKHHKLTLSYNDELVSFILANCRLAET
GARNIDAVINRQLLPQLSTQLLAHDKDDTHTQIVISIDEQGTLGYVFS
 
Nucleotide Sequence: 2667 bp     [Download]
>gi|197336667|ref|NC_011186.1|:919176-921842 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGATAAATATAAATCTCTCTTCTTTAATACAACGTCTACACCCTATTACAAAGGTAGCTCTTGAAGATG
CAGCTGCATTAGCTGTTTCTGAACGTGCATCTGAAGTACAAATCGAACACTTTTTATTAAGCTTGCTTGA
ACGCCCAAATAGCGATTTTGACCAACTACTCGCTCATTTTGAATGTTCTGAAAACTTATTGCGCCAAGCA
ATCAAATCAACGCTAGAAAACAGTCATAAAAGCAATGGTGGCAAACCAGTATTTTCAGCAATGCTAATTG
AATGGTTACAAGAAGCATGGTTAGTTTCATCACTTGACTTATCAGAAACTCAAATTCGCTCTGGTGCATT
ACTGCTTACATTAATTAGCAATCCATTAAGATATGGTCAACATGGTTACTCTTCTCTGTTGGAGAACATC
AACCCAGAAACACTGAAACGTAACTTTGCTGAATTAACATCACGTTCAATTGAATCTCAAGTCGCTACAT
CAGAACAAACTCATGCTCGCGAAGACGGGTCAGCATTAAGTAAATTCACAACAGACTTTACTGGCAAAGC
ACGTAAAGGGGAAATTGACCCAGTATTCTGTCGTGACCAAGAAATTCGACAAATCATTGATATCCTAGCG
CGTCGACGTAAAAACAACCCTATCGCGGTTGGTGAACCAGGCGTTGGTAAAACAGCCGTAGTTGAAGGTT
TAGCACTTAAAATTGTTCAAGGCGAAGTTCCTGATTGCTTAAAAGGTGTTGAGCTTTACGGTTTAGACAT
GGGATTACTTCAAGCAGGCGCAAGCGTAAAAGGTGAATTTGAAAAACGCCTAAACGCTGTGTTAGACGAA
GTTAAGAATTCTCCAACCCCAATTATTCTTTTTATTGATGAAGCACATACGCTTGTCGGTGGCGGTAATC
AAGCTGGTGGTAGTGATGCCGCTAACTTATTGAAACCAGCGCTTGCTCGCGGTGAAGTAAAAACCATTGC
AGCAACAACTTGGTCAGAGTATAAAAAATATTTTGAAAAAGACCCTGCTTTAGCACGTCGATTCCAATTA
GTTAAACTGGATGAGCCATCAACTGAACAAGCCGCTTTAATCATTCGTGGTCTGCGCGCCGTTTATGAAA
AATCACACAATGTTTATGTCCGTGATGATGCAATTACTGCTGCGGCAACCCTATCTGACCGTTATATTTC
TGGTCGCCAACTACCAGATAAAGCCATTGATGTATTAGATACAGCATGTGCTCGTGTAAACATCAGTTTA
AACGCCATTCCTGCCCCAATCGAAACGTTACAACAAGAAATTGCAGCTCTAGAGCGTGAACTTGAAGCAT
TAGAGCGAGATCAGTTACAGCAAACAGGTGATCGCCATGCCCTTGCTGCAATTCCAGAATTAAAAGCTCG
TATGGATGAAGCGTTGGAAGAACAATCAATACTTCAACATCAGTGGAAAAAAGAGCAAGCTCTAATTAAT
GAAATGATTGAGTTACGTGCACACTTGCATGATCTAACATTAGGTACACCTTCTAATGAAGACGTTGATG
ATGAAGATAACCAAGACAAGCCTGCATGCTCTCAATTTACAGAGGAAGAAACGCGTCAAGCAATTCATAC
TTGTAACGAACAACTAGAGGCTGCACGTGGTAATAGCCCTCTTGTTCACTTTGAGGTAGGTCCTGATGAA
ATCAGTCATGTTATTTCAGATTGGACAGGCATTCCTATGGGCAAAATGCTACAAGATGAAGCAGAAACAA
CATTAAATCTAGTATCGTCATTAACTGAGAGCATTAAAGGTCAGCCTTATGCTATTGAAGCTTTAGCTGA
AGGATTACAAACAGCGAAAGCTGGATTGGTTAATCCAGATGCACCAACCGGTGTATTCTTACTTGTTGGT
CCAAGTGGTGTTGGTAAAACTGAAACTGCACGAGCAATTGCAGATCAAATGTTTGGTGGCGAACGCTTCA
TGACGACCATTAACATGTCAGAATTCCAAGAAAAACATACGGTTTCACGTTTAATTGGTTCACCTCCAGG
TTATGTAGGTTATGGCGAAGGTGGTATGTTAACGGAAGCAGTACGTCAACGTCCTTATTCTGTTGTTCTA
CTGGATGAAGTTGAAAAAGCAGATCCAGAAGTATTGAATTTATTCTACCAAGTATTTGATAAAGGCACAT
TAAATGACGGTGAAGGTCGAACTATCGACTTTAAGAACACCTTAATCATTATGACAAGTAACCTTGCTAC
TCATGAAATTGAATCTTTAGTACAACAATCGAAAGATATCGATGCAAATATTGTTGCTGAGGCCATTCGC
CCAACGTTAAACAGCCACTTTAAGCCAGCATTACTAGCTCGTATGAACGTATTACCATTCTTACCTCTAA
ATGATGAAGCAATGACTGATATCATCATTCATAAGCTAAATAAAGTATCTAAACGCTTAGAGAAGCACCA
TAAGTTAACCCTAAGCTACAACGATGAACTAGTGTCATTCATTCTTGCTAATTGTCGACTTGCGGAAACT
GGTGCTCGTAATATTGATGCTGTAATTAACCGTCAGCTATTACCTCAACTTTCAACTCAATTATTAGCAC
ACGATAAAGATGATACACATACTCAAATCGTGATTTCAATTGATGAGCAAGGAACACTAGGTTATGTCTT
TAGCTAA