SecReT6
Protein ID: 197336905
SecReT6 ID300
T6SS typei1
Gene symbol-
Locus tagVFMJ11_A0819
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]903349..904347 [-]
Producttype VI secretion protein, family
NoteTssG
UniProt IDB5EUK0
KEGG IDvfm:VFMJ11_A0819
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-83, Aligned region: 8..318
Protein Sequence: 332 a.a.     [Download]
>gi|197336905|ref|YP_002158368.1| type VI secretion protein, family [Vibrio fischeri MJ11]
MIQYIVNKPCDYSFFQAVSLLEKHYQNLSGIEYKAIGENQYVKNEYIQFSVSPKLSFPKSDIEFITEFER
NDATYTQIEVNFMGLHGVSSPLPASYTEKLAGRDPDDNPVKEFFDFFHHRYISMLYRVWKKYRYHIQYKS
DAKDPFSGRLLHLVGLSSVIQESNEVDLDRAKLLSYVNQLSTRTRSPKLVSGIVSHYFSLSNVYIEEWVY
RRITIAVSQRNCLNRKNCQLGGDFHLGQSMADLTGKFNLCIDDIDFDTYVKFLPGGALHETLIGLMKFIL
CDPMAWDLKLTVRNKSLPINQLGDGLGNELGQTFWLGSAKGEETKIKIVGSN
 
Nucleotide Sequence: 999 bp     [Download]
>gi|197336667|ref|NC_011186.1|:c904347-903349 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGATTCAATATATTGTTAATAAACCATGTGATTATAGCTTCTTTCAAGCGGTCTCTTTACTTGAAAAGC
ACTATCAGAATTTATCGGGTATTGAATATAAAGCTATTGGTGAGAATCAATACGTAAAGAATGAATATAT
TCAATTTAGCGTATCTCCAAAACTTAGTTTCCCTAAAAGTGATATTGAATTTATTACTGAATTTGAGCGT
AACGATGCGACTTATACACAAATAGAAGTTAACTTTATGGGGCTGCATGGTGTGAGTTCGCCATTACCGG
CTTCGTATACGGAAAAGTTAGCAGGAAGAGATCCTGACGATAATCCTGTAAAAGAGTTTTTCGATTTTTT
CCATCATAGATACATAAGTATGCTTTATCGAGTATGGAAAAAATATCGATATCATATTCAATATAAGAGT
GATGCTAAGGATCCTTTTTCTGGGCGCTTATTGCATTTAGTTGGATTATCTAGCGTAATTCAAGAAAGTA
ACGAAGTTGATTTAGACAGGGCGAAATTACTTTCCTATGTTAATCAACTTTCGACGCGTACACGTTCACC
AAAACTTGTTTCTGGTATCGTTTCCCATTACTTTTCGCTCTCAAATGTATACATAGAAGAATGGGTATAC
AGACGGATTACTATTGCGGTTTCTCAACGAAATTGTCTTAACCGAAAGAATTGTCAATTAGGTGGAGATT
TTCACTTAGGTCAAAGTATGGCTGATTTAACGGGGAAATTTAATCTGTGTATTGATGATATTGATTTTGA
TACCTATGTAAAATTTTTACCCGGTGGTGCGTTACACGAAACGTTGATTGGACTGATGAAATTTATTTTA
TGCGATCCAATGGCGTGGGACCTAAAGCTTACTGTACGAAATAAATCATTACCTATAAATCAATTAGGTG
ATGGTTTGGGAAATGAGCTTGGACAAACATTTTGGCTAGGATCGGCAAAAGGAGAGGAAACGAAAATTAA
AATAGTAGGCAGTAACTAA