SecReT6
Protein ID: 197336955
SecReT6 ID300
T6SS typei1
Gene symbol-
Locus tagVFMJ11_A0830
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]916044..918122 [-]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDB5EUL1
KEGG IDvfm:VFMJ11_A0830
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.80E-70, Aligned region: 27..331
Phage_base_V [PF04717], Evalue: 1.40E-23, Aligned region: 371..464
Gp5_C [PF06715], Evalue: 5.40E-05, Aligned region: 505..522
Gp5_C [PF06715], Evalue: 5.40E-05, Aligned region: 534..543
Gp5_C [PF06715], Evalue: 5.40E-05, Aligned region: 547..564
Gp5_C [PF06715], Evalue: 5.40E-05, Aligned region: 568..591
Gp5_C [PF06715], Evalue: 5.40E-05, Aligned region: 593..611
Gp5_C [PF06715], Evalue: 5.40E-05, Aligned region: 617..635
Gp5_C [PF06715], Evalue: 5.40E-05, Aligned region: 675..686
Protein Sequence: 692 a.a.     [Download]
>gi|197336955|ref|YP_002158379.1| Rhs element Vgr family protein [Vibrio fischeri MJ11]
MVSDIEFKFEVLGTEHEFRVESFNVVEELSKPFHVSLSLLSLDADITFDELIRKPALLSIFGQGVGTARQ
FHGVVNEVRYLGEGRRFSRYQITLVPQLWFLTQRQDCRIFQEKSVVDIVTEVLDGAAVTDYRFDISALYP
TKEYVLQYRESDSHFVQRLLAEHGLWYYFEHTTANHTMVIVDKNDAIAELENTPLNSSYVGPVIYQADGG
GNADREHIFDLESINRVRTGHVTHTDYNYEQPRIPQKMESSGLIDTDLAFFDYPGRYIEPSQGLVRADEL
MAESVVDNYQIEAASNVMRLIPGYSFILDKHPRRALNRDYTILTVTHSGYDPQVHEDEANEMPTTYQNQF
SCLPRDIEFKAPKIAAPVVDGPQTAVVVGPAGEEIYTDKLGRIKVQFHWDRYGQSDEHSSCWIRVSQSMA
APTWGAVYLPRIGHEVVVAFLEGDPDRPLVTGAVYNGLHYPPYSLPENKTRTTFRTQTHKGTGYNELSFE
DEANQEEVYIHAQKDMSTKVLNNRYRTIGQDEFLIVERHQTNEVKGDHKETIEGHKTTTVNSTFTETVEQ
DVTVKYNANETQSITNNSTLDIGDNRTTSIGKNDDLSVTENSNLSVGASRNSDISADDNQTVGGNLTVSV
QGNTSYKTDGATQIISGSKIVLQTGSSSLVMSSDGTIKLAGNAITIEGSSTVTVKGGKVAVN
 
Nucleotide Sequence: 2079 bp     [Download]
>gi|197336667|ref|NC_011186.1|:c918122-916044 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGGTTAGCGATATAGAATTTAAGTTTGAAGTTCTTGGCACAGAACACGAATTTCGTGTCGAGAGCTTTA
ATGTAGTAGAGGAGCTGTCTAAACCGTTTCATGTCAGCTTATCATTACTTTCACTTGATGCAGATATTAC
GTTTGATGAGTTGATCAGAAAACCTGCATTATTAAGTATATTTGGTCAAGGTGTTGGAACAGCACGCCAG
TTTCATGGTGTCGTTAACGAAGTTCGTTATCTAGGTGAAGGACGTCGTTTTTCACGTTATCAAATTACGT
TAGTACCACAGTTGTGGTTTTTAACGCAACGTCAAGATTGTCGTATTTTCCAAGAAAAATCCGTGGTTGA
TATTGTTACTGAAGTATTAGATGGTGCAGCAGTAACTGATTATCGATTTGATATTTCGGCTTTATATCCG
ACAAAAGAATACGTTTTACAATATCGCGAAAGTGATAGTCATTTTGTACAGCGTTTGTTGGCTGAGCACG
GCCTGTGGTACTACTTTGAACATACAACAGCTAATCACACAATGGTTATTGTTGATAAAAACGACGCTAT
TGCAGAGTTGGAAAATACTCCGTTAAACTCTTCATATGTTGGCCCTGTTATCTATCAAGCTGATGGTGGT
GGTAATGCGGATAGAGAACATATCTTTGATTTAGAATCAATTAATCGAGTACGTACCGGCCATGTAACTC
ATACTGATTATAATTATGAACAGCCACGTATTCCTCAAAAAATGGAAAGTTCGGGACTAATTGATACTGA
TTTAGCTTTTTTTGATTATCCTGGACGTTATATTGAGCCGTCTCAAGGCTTAGTTCGTGCTGATGAACTG
ATGGCTGAAAGTGTTGTTGATAATTATCAGATTGAAGCTGCAAGTAATGTAATGCGATTAATTCCGGGTT
ACAGTTTTATTCTAGATAAACATCCAAGAAGAGCACTTAATCGAGATTATACAATTTTGACGGTAACGCA
TAGTGGTTATGATCCTCAAGTTCATGAAGATGAAGCCAACGAAATGCCAACCACATATCAAAATCAGTTT
AGTTGTTTACCGCGTGATATTGAGTTTAAGGCGCCTAAAATTGCTGCTCCTGTTGTTGATGGTCCACAGA
CTGCTGTTGTTGTTGGACCAGCAGGTGAAGAAATTTATACTGATAAGCTTGGGCGTATCAAAGTGCAATT
TCATTGGGATCGTTATGGTCAAAGTGATGAGCATTCAAGTTGTTGGATCCGTGTTAGTCAGTCGATGGCT
GCTCCGACATGGGGCGCTGTATATTTACCAAGAATTGGTCATGAAGTAGTCGTTGCTTTTTTAGAAGGTG
ATCCTGACCGTCCATTAGTTACAGGTGCGGTATATAACGGGCTGCATTACCCGCCATATTCTTTACCTGA
AAATAAAACACGCACAACCTTTAGAACTCAAACTCATAAAGGTACAGGGTATAACGAGTTAAGCTTTGAA
GATGAAGCTAACCAAGAAGAAGTTTATATCCACGCACAAAAAGACATGTCGACCAAAGTCTTGAATAATC
GCTATAGAACTATTGGTCAAGATGAGTTTTTAATTGTCGAACGTCATCAAACAAATGAAGTGAAAGGCGA
TCACAAAGAAACGATTGAAGGGCATAAGACAACAACGGTTAATAGTACGTTTACTGAAACGGTCGAACAA
GATGTAACGGTTAAATACAATGCAAATGAAACGCAATCAATAACCAATAATTCAACATTAGATATTGGTG
ACAACCGTACAACAAGTATTGGTAAAAATGATGACTTGAGCGTAACAGAAAATAGTAATTTGTCTGTTGG
GGCATCTCGTAATAGTGATATTTCTGCCGATGATAATCAAACCGTTGGAGGAAATTTAACGGTTTCTGTT
CAAGGAAATACATCTTATAAGACCGATGGCGCAACGCAAATTATTAGTGGCAGTAAAATTGTATTGCAAA
CAGGGAGTTCTTCTTTAGTCATGAGTAGTGACGGTACTATTAAATTAGCAGGTAATGCGATTACTATTGA
AGGCTCAAGTACAGTAACAGTGAAAGGTGGTAAGGTTGCAGTTAACTAA