SecReT6
Protein ID: 197337045
SecReT6 ID300
T6SS typei1
Gene symbol-
Locus tagVFMJ11_A0808
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]881062..881853 [+]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDB5EUI9
KEGG IDvfm:VFMJ11_A0808
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-53, Aligned region: 46..248
Protein Sequence: 263 a.a.     [Download]
>gi|197337045|ref|YP_002158357.1| type IV / VI secretion system protein, DotU family [Vibrio fischeri MJ11]
MSYVEDDVTVVLFQPEPGKPMEVMPAPDLSRNISVSELDISSMGINPLVDQFSWLIASLSCMSSIPWLDD
PMPFREQVAREIRKGERMLNEMEVDRASILVIRYCLCAAMDESVCRQEWGANSNWSQNSLLSEFHNETSG
GDKFFVILDRLKADPRKYRHVIEFLYLLLQLGFKGKYGRAERGAESLTEIGNTIYRLVRDERLAEQEKVA
LVDVKSKYLKKPLKRVLPPKLILGVSALLFAAMYAATYLVIDVRFQKLLSLYQ
 
Nucleotide Sequence: 792 bp     [Download]
>gi|197336667|ref|NC_011186.1|:881062-881853 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGAGTTATGTTGAAGACGACGTAACAGTTGTACTTTTCCAACCTGAGCCGGGCAAACCCATGGAGGTTA
TGCCCGCCCCTGATTTATCTCGTAATATTTCAGTCAGTGAATTGGATATTTCATCTATGGGGATCAACCC
ATTAGTTGACCAATTCTCATGGCTTATTGCGAGCTTATCTTGTATGTCTTCCATTCCATGGCTTGATGAT
CCTATGCCTTTTCGTGAGCAAGTCGCTCGTGAAATACGTAAAGGTGAACGTATGCTCAACGAAATGGAAG
TCGACCGTGCATCTATTCTGGTTATCCGTTATTGCTTATGTGCTGCAATGGATGAATCGGTATGCCGTCA
AGAATGGGGAGCCAACAGTAACTGGAGCCAAAACAGCTTATTATCTGAATTTCATAATGAAACCTCAGGT
GGCGATAAGTTTTTTGTCATTTTAGATAGATTAAAAGCAGATCCTCGCAAGTATCGTCATGTGATCGAAT
TCTTATATTTACTCCTACAACTGGGTTTTAAAGGTAAATATGGTCGAGCTGAGCGTGGTGCTGAGAGTTT
GACTGAGATCGGCAACACTATCTACCGTTTGGTTCGTGACGAGCGTCTGGCTGAGCAAGAAAAAGTGGCA
TTAGTTGATGTCAAATCCAAGTACTTAAAAAAACCATTAAAACGCGTACTGCCTCCAAAGTTAATCCTTG
GCGTCAGTGCTTTGCTATTTGCGGCCATGTATGCCGCTACGTATCTCGTTATTGATGTTCGATTTCAAAA
GCTACTGTCTCTTTACCAGTAG