SecReT6
Protein ID: 197337170
SecReT6 ID300
T6SS typei1
Gene symbol-
Locus tagVFMJ11_A0821
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]906105..906515 [-]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDB5EUK2
KEGG IDvfm:VFMJ11_A0821
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-19, Aligned region: 24..116
Protein Sequence: 136 a.a.     [Download]
>gi|197337170|ref|YP_002158370.1| type VI secretion system lysozyme-related protein [Vibrio fischeri MJ11]
MEKGYRLLERIELGEPKNCYEKVVSHKHLIESIHLHLADLLNTHAGNAMIDNDYGLPDFNDVLSNNTNLV
RNIQQNIKVSIEKFEPRMRNVEVHYRHDNNNPLQLGFGIGGEVIHNGGKVPMAINIFMGVDGQFNV
 
Nucleotide Sequence: 411 bp     [Download]
>gi|197336667|ref|NC_011186.1|:c906515-906105 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGGAAAAAGGTTATCGATTACTTGAGCGAATTGAATTAGGTGAACCAAAAAATTGTTACGAAAAAGTCG
TTTCACATAAGCATTTAATTGAATCTATTCATCTCCACCTTGCTGATTTACTTAATACTCACGCAGGAAA
CGCGATGATAGATAACGATTATGGATTACCTGATTTTAATGATGTGTTGTCCAATAACACCAATTTAGTT
CGTAATATTCAACAGAATATTAAAGTGTCTATCGAAAAGTTTGAACCAAGAATGCGTAATGTTGAGGTTC
ATTATCGTCATGATAACAATAATCCACTTCAACTCGGTTTTGGCATCGGTGGAGAAGTGATTCATAACGG
TGGTAAAGTCCCAATGGCGATCAATATCTTTATGGGCGTCGACGGTCAGTTTAATGTGTAG