SecReT6
Protein ID: 197337278
SecReT6 ID300
T6SS typei1
Gene symbol-
Locus tagVFMJ11_A0806
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]879228..879728 [+]
Producttype VI secretion lipoprotein, family
NoteTssJ
UniProt IDB5EUI7
KEGG IDvfm:VFMJ11_A0806
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.10E-33, Aligned region: 11..152
Protein Sequence: 166 a.a.     [Download]
>gi|197337278|ref|YP_002158355.1| type VI secretion lipoprotein, family [Vibrio fischeri MJ11]
MRKLLTFSLIFLLSGCTMWDQFKESTGITPETSSIELIITADKVLNVREGGQSSPVILRIHELNSPVLFR
NLDFFALFENDKDALGDEYIKRYEYQIQPGDVVHETLVLDPATRAIGFSVAFRDINGSSWRKVELIEEKS
EYFLKLNLKESELSSNNTRGIEQIYF
 
Nucleotide Sequence: 501 bp     [Download]
>gi|197336667|ref|NC_011186.1|:879228-879728 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGCGAAAATTACTCACGTTTTCTCTTATTTTTTTATTATCTGGCTGCACTATGTGGGATCAGTTTAAAG
AATCAACAGGAATTACCCCTGAAACCTCTTCTATCGAGTTAATTATTACAGCAGATAAAGTATTAAATGT
TCGTGAAGGTGGGCAATCATCACCCGTCATATTGCGGATTCATGAACTAAACTCCCCTGTTCTTTTTCGT
AACCTTGATTTCTTTGCGTTATTTGAAAATGACAAAGATGCACTTGGTGATGAATATATAAAACGATACG
AATACCAAATTCAGCCCGGGGATGTAGTTCATGAGACTCTGGTATTAGACCCAGCGACTCGAGCTATCGG
TTTCTCTGTAGCATTTAGAGACATAAACGGATCATCTTGGCGTAAAGTCGAGTTAATCGAAGAAAAAAGC
GAATACTTCTTAAAGCTAAACCTGAAAGAAAGTGAACTTAGCTCCAACAATACTCGCGGTATTGAGCAAA
TATATTTTTAA