SecReT6
Protein ID: 197337608
SecReT6 ID300
T6SS typei1
Gene symbol-
Locus tagVFMJ11_A0823
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]908062..908571 [-]
Producttype VI secretion protein, family
NoteTssB
UniProt IDB5EUK4
KEGG IDvfm:VFMJ11_A0823
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.80E-60, Aligned region: 5..158
Protein Sequence: 169 a.a.     [Download]
>gi|197337608|ref|YP_002158372.1| type VI secretion protein, family [Vibrio fischeri MJ11]
MSRDGSVAPKERINIRYVPATGDVQEDVELPLSMMVVGDFTARTDETPIEDRTPINIDKDNFNDVMEGYS
PNVKVNVDNKLSDEEGAQLGVDLTFNSMKDFSPEAIAKSVPELNGLLELREALVALKGPLGNVPAFRKKI
AAVLQDEEARQKLLEELNIGSAKEEAKAE
 
Nucleotide Sequence: 510 bp     [Download]
>gi|197336667|ref|NC_011186.1|:c908571-908062 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGTCACGTGATGGCTCGGTTGCTCCTAAAGAGCGTATTAATATTCGTTATGTTCCTGCAACAGGGGATG
TACAAGAAGACGTTGAACTGCCACTAAGTATGATGGTTGTTGGTGACTTTACAGCTCGTACTGATGAGAC
TCCAATTGAAGACCGTACTCCTATTAATATCGATAAAGATAACTTTAATGATGTTATGGAAGGTTATTCT
CCGAACGTTAAAGTAAATGTTGATAATAAACTTAGCGATGAAGAAGGTGCTCAGTTAGGTGTCGATTTAA
CGTTTAATAGCATGAAAGATTTTTCGCCAGAAGCTATCGCGAAAAGTGTACCAGAGCTGAATGGTTTACT
TGAATTACGTGAAGCGTTAGTTGCTTTAAAAGGTCCATTAGGCAATGTTCCTGCATTCCGTAAGAAAATT
GCAGCAGTACTTCAAGATGAAGAAGCACGACAAAAATTATTAGAAGAGCTAAATATTGGTTCGGCTAAAG
AAGAAGCTAAGGCTGAATAG