SecReT6
Protein ID: 197337659
SecReT6 ID300
T6SS typei1
Gene symbol-
Locus tagVFMJ11_A0824
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]908630..910189 [-]
Producttype VI secretion-associated protein, family
NoteTssA
UniProt IDB5EUK5
KEGG IDvfm:VFMJ11_A0824
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.40E-16, Aligned region: 48..108
Drc1-Sld2 [PF11719], Evalue: 0.0063, Aligned region: 190..311
Protein Sequence: 519 a.a.     [Download]
>gi|197337659|ref|YP_002158373.1| type VI secretion-associated protein, family [Vibrio fischeri MJ11]
MTSLNVELLLKPISEASPTGEESKYEFCYELMELEIKKFGSLFGETVDWKVVETNAIEVLTTYSKDLKAI
CYLIRALIERNGFIGLDEGLNLLKQSLVLFGTDLFPQRKRARDGAMEWFVAQLETTLPKLDTSTTNWESV
ASYLQRINEISDQYHEAFSDSDVEFYLITSVLNGISQRVVGVSETNTNTSVKMTSEPEPLVEETTSAVTE
VKTPSQVATKVPKTVNTVKQEVDIDTDFSSPSASKRTLKKVAEFMLHSDISTPLAYRLHRNCTWCEVDEL
PPHDNDKKTPLSLAVSQDQLSEYRDKAKQETEAEVIKRLERTLTDAPFWLTGHYLMFQMLTNLDHHEAAE
AVKQETQYFISQLEGIELLTFANSTPFADEETLKWLSSNTTTTPVAVAAVSVDYTEDDSLIEGEITLENL
GEYVSRIAQNLASDPSGRGQWMLHYKLVKAYRFVGLLPLCLPYIEKMWSIKEEINLSNWEPHLCNQLDLL
VNEVLSEMYPVKEHMPEKYQQWLSINNTN
 
Nucleotide Sequence: 1560 bp     [Download]
>gi|197336667|ref|NC_011186.1|:c910189-908630 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGACAAGTTTGAATGTTGAACTGTTATTGAAACCGATATCTGAAGCTTCGCCTACTGGTGAAGAATCAA
AGTACGAGTTTTGTTATGAATTAATGGAACTGGAAATTAAAAAGTTTGGTTCTTTGTTTGGTGAAACCGT
TGATTGGAAAGTAGTTGAGACAAATGCCATTGAAGTGTTGACTACCTACAGTAAAGATTTAAAAGCTATT
TGCTACTTGATTCGAGCATTAATTGAGCGCAATGGATTTATCGGTCTAGATGAAGGACTTAATTTACTGA
AGCAAAGTTTAGTTTTGTTTGGTACCGATCTATTCCCACAACGTAAACGTGCTCGTGATGGCGCAATGGA
GTGGTTTGTTGCTCAATTAGAAACAACATTGCCAAAGCTTGATACTTCAACAACTAATTGGGAAAGTGTT
GCTTCTTATTTGCAAAGAATCAATGAAATTAGCGATCAATATCATGAGGCGTTTTCAGATTCTGATGTTG
AATTTTATTTGATCACATCAGTATTAAATGGAATCTCACAACGAGTTGTTGGTGTGAGTGAAACAAATAC
CAACACTTCAGTAAAAATGACTAGTGAACCAGAACCACTGGTAGAAGAGACTACATCAGCGGTTACTGAA
GTTAAAACACCATCACAGGTTGCGACTAAAGTACCGAAAACGGTTAATACAGTTAAACAAGAAGTTGATA
TTGATACAGACTTTTCTTCTCCAAGTGCCTCTAAGCGAACTTTGAAGAAAGTAGCGGAATTTATGTTGCA
TTCTGATATATCAACACCACTTGCTTATCGGTTACACCGTAATTGTACATGGTGTGAAGTGGATGAATTA
CCTCCACATGATAATGATAAAAAAACACCACTAAGCCTTGCGGTATCGCAAGATCAGTTAAGTGAATATC
GAGATAAAGCCAAACAAGAAACAGAAGCAGAGGTGATTAAGCGTCTAGAAAGAACGTTAACTGATGCTCC
ATTTTGGCTAACTGGTCATTATTTGATGTTTCAAATGCTTACTAATTTGGATCATCACGAAGCAGCAGAA
GCTGTTAAGCAAGAGACTCAGTACTTTATTTCTCAACTTGAAGGCATTGAATTATTAACCTTTGCCAATT
CAACCCCATTTGCTGATGAAGAGACATTGAAATGGCTTTCTTCGAATACAACGACTACACCCGTAGCTGT
TGCTGCTGTATCTGTTGACTACACAGAAGACGATAGCTTGATTGAGGGGGAAATAACGTTAGAAAATTTA
GGGGAGTACGTATCACGTATTGCCCAAAACTTGGCTAGTGATCCGTCAGGACGAGGCCAATGGATGCTCC
ATTATAAATTAGTTAAGGCGTACCGCTTTGTTGGCTTATTGCCTCTTTGTTTGCCATATATTGAAAAAAT
GTGGTCGATTAAAGAAGAAATAAATCTTAGCAATTGGGAACCTCATTTATGTAATCAGCTTGACTTGTTG
GTTAATGAAGTCTTATCAGAAATGTACCCCGTAAAAGAGCACATGCCTGAAAAGTACCAACAGTGGCTAT
CAATTAATAATACCAACTAG