SecReT6
Protein ID: 197337689
SecReT6 ID300
T6SS typei1
Gene symbol-
Locus tagVFMJ11_A0816
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]898055..899359 [+]
ProductImpA-related N-terminal family protein
NoteTssA
UniProt IDB5EUJ7
KEGG IDvfm:VFMJ11_A0816
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.50E-16, Aligned region: 46..103
Protein Sequence: 434 a.a.     [Download]
>gi|197337689|ref|YP_002158365.1| ImpA-related N-terminal family protein [Vibrio fischeri MJ11]
MNLSDFARRPISKETPSGINPNSLDNFSEIKREVNKLNTVTSKISWKNVFKLSRNILETESKDIRCACYY
TVSATHIDGLKGLVNGLNALLDICVIYWHSGYPDVNKTTARMGAFEWLTEHAIKKQKTLKISPTDLVLIE
TGHKLTLKIEEELRSHYGNKSPSLGAIRRIFSQWIEEIQTTKLSLEEQRLKKEAIEKQNNSGINVNVSLP
PRDESKKTVQPTMTHTEKDKNIKPMVTISLAFIFILTLLFGHFLYADNQKSTLLINIQKADLTTINPLIS
QLENKEDDLKQYVKTALIKQALHLNKDWEVTSTKVDKIDELETLNHSLKNLYPDSAAVKKLEYEFNQQRA
DFENEYSDIHRRFLKSRTIFANAKNHNSDENIVKAYSYSNSLFPLLGRIEYAEKQNSLEELNRTQYLLNV
YQHKLNTIRKNIQQ
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|197336667|ref|NC_011186.1|:898055-899359 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGAATCTTTCTGATTTTGCGCGACGTCCTATATCTAAAGAAACACCTTCAGGTATCAACCCTAACTCAT
TGGATAATTTTTCTGAAATTAAACGTGAAGTTAACAAATTGAATACGGTTACTTCTAAGATATCTTGGAA
AAATGTTTTCAAACTATCAAGAAACATTTTAGAAACAGAAAGTAAAGATATTAGATGTGCTTGTTATTAT
ACTGTTTCAGCAACCCATATTGATGGATTAAAAGGGTTAGTTAATGGCTTAAACGCTCTATTAGATATCT
GCGTTATTTATTGGCATTCAGGATACCCTGATGTAAATAAAACTACTGCTCGAATGGGTGCATTTGAGTG
GTTAACTGAACACGCCATAAAAAAACAAAAAACATTAAAAATATCCCCTACTGATCTAGTGCTTATCGAA
ACTGGGCATAAATTAACATTAAAGATAGAAGAAGAGCTTCGTTCTCACTATGGGAACAAAAGCCCTTCTC
TCGGAGCTATTCGTCGCATCTTCTCACAATGGATCGAAGAAATTCAAACAACAAAATTAAGTCTCGAAGA
ACAGCGCCTCAAAAAAGAAGCTATAGAAAAACAAAATAATTCTGGTATTAACGTTAATGTATCTCTCCCA
CCAAGAGATGAGAGTAAAAAGACAGTTCAGCCTACAATGACTCATACCGAAAAAGATAAAAATATAAAGC
CAATGGTAACGATTTCGCTAGCATTTATCTTTATTTTGACATTATTGTTTGGGCACTTTTTATACGCAGA
TAATCAAAAAAGCACGTTACTTATTAATATCCAAAAAGCTGACTTAACGACCATTAACCCTTTAATATCT
CAACTAGAGAATAAGGAAGATGATCTTAAACAATACGTAAAGACAGCACTAATCAAACAAGCGTTACATT
TAAACAAAGACTGGGAGGTTACCTCAACAAAAGTCGATAAAATCGACGAACTAGAAACATTGAATCACAG
TTTAAAAAATTTATACCCGGATTCTGCTGCAGTCAAAAAATTAGAATATGAATTCAATCAGCAACGTGCT
GATTTTGAAAATGAATACAGTGATATTCATCGACGTTTTCTCAAATCAAGGACGATATTTGCCAATGCAA
AAAATCATAATTCAGACGAAAATATTGTTAAAGCATACAGTTACAGTAATTCACTCTTCCCTCTGTTAGG
AAGAATTGAATACGCTGAAAAACAAAACTCATTAGAAGAGCTAAATCGCACTCAATATTTACTTAATGTT
TATCAACACAAATTGAATACAATACGAAAAAACATTCAGCAGTAA