SecReT6
Protein ID: 197337793
SecReT6 ID300
T6SS typei1
Gene symbol-
Locus tagVFMJ11_A0805
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]877772..879226 [+]
Producttype VI secretion system FHA domain protein
NoteFha
UniProt IDB5EUI6
KEGG IDvfm:VFMJ11_A0805
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.20E-16, Aligned region: 31..97
Protein Sequence: 484 a.a.     [Download]
>gi|197337793|ref|YP_002158354.1| type VI secretion system FHA domain protein [Vibrio fischeri MJ11]
MHLNQLTLFITKSPEEYTGSKHIEMPEGGGSLGRNPSNTVSLVDHNRFISGSHCLISIYGDTYYLSDVST
NGTLVNGNKLLKNQPISLYDGDTIVLGRYEISVGLEKLSNSINIAADISEETDSTDPLVNLAEYTPDEEQ
DKGNIADLFKETRIDKVDSSDPVAHLNFITQTNNDDHLLHGNEKKHEQKINEPVHTRQLLDDSDSVHSEF
DVPNLIPEDWFSNDLANTSMPPVQIDEPIATSSESEPMVHSFVDSTPETIIPSVTEQLAWEDVTQTIQPS
VSTTEPKSDEFFIAPSTSMDVYPSQSIETSFNSKMSDDAASAFYKGLGMSASQIEQTDEQFFQQMGNCLR
LCINNLQKELSELKAIKNNEQDDSMTNIVELMLSLNHQQLLSPNELIEQILDELDSHKLNMTNATNDVIN
NKLLMLHPEKFAQDVRSQSRFKASGKLWKEYIAFYQNHNNKKIDISSSVVQQKIKEQYTKRLKA
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|197336667|ref|NC_011186.1|:877772-879226 Vibrio fischeri MJ11 chromosome II, complete sequence
GTGCATTTAAACCAACTCACCCTGTTTATCACAAAGTCACCAGAAGAATATACAGGTAGCAAACATATTG
AAATGCCAGAAGGCGGGGGTTCATTAGGTCGAAATCCAAGCAATACGGTAAGTTTAGTCGACCATAACCG
CTTTATTTCTGGCTCGCATTGCTTAATTAGTATTTACGGTGATACCTATTACCTAAGTGATGTTAGTACT
AATGGCACGTTAGTTAACGGAAATAAGTTATTAAAAAACCAGCCAATTTCACTTTACGATGGTGATACGA
TTGTTCTTGGTCGATACGAAATATCTGTTGGATTAGAAAAACTATCTAACTCAATAAACATTGCCGCGGA
TATTTCGGAAGAAACAGACTCAACCGATCCGTTAGTTAATCTTGCTGAATACACTCCAGATGAAGAACAA
GATAAAGGTAACATTGCAGATCTGTTTAAAGAAACTCGTATAGATAAAGTTGATAGCAGTGATCCTGTTG
CTCATCTAAATTTCATTACCCAAACCAATAATGATGATCATTTATTGCATGGGAATGAAAAAAAACACGA
ACAAAAAATCAATGAACCAGTCCATACTCGTCAATTACTTGATGATAGCGATAGCGTACACTCAGAATTT
GATGTCCCTAATTTAATTCCTGAAGATTGGTTTTCTAATGATTTAGCTAATACATCAATGCCACCAGTTC
AAATTGATGAACCAATAGCCACATCTTCAGAGTCAGAACCCATGGTACATTCATTTGTTGACTCTACACC
AGAGACAATAATTCCATCAGTTACTGAGCAGTTGGCTTGGGAAGATGTGACTCAAACCATTCAACCGTCA
GTCTCAACAACTGAACCGAAAAGTGATGAGTTTTTTATCGCACCTTCAACATCTATGGATGTGTATCCAT
CACAATCAATAGAAACGTCATTCAACTCAAAAATGAGTGATGATGCCGCATCTGCTTTTTACAAAGGTTT
AGGAATGTCAGCCTCGCAAATAGAACAAACAGACGAGCAATTCTTCCAACAGATGGGGAATTGTTTACGC
CTATGTATCAACAATTTGCAAAAAGAACTCTCTGAGCTAAAAGCAATAAAAAATAATGAACAAGACGATT
CAATGACTAATATTGTTGAACTCATGCTGTCTTTAAATCATCAACAACTGCTATCACCTAACGAATTGAT
AGAACAGATATTAGATGAACTAGACAGTCATAAATTAAACATGACTAACGCAACCAATGACGTCATCAAC
AATAAGTTACTGATGCTGCATCCTGAAAAATTTGCTCAAGACGTGCGTTCACAATCACGCTTTAAAGCAA
GCGGTAAATTATGGAAAGAATATATCGCGTTTTATCAAAACCATAATAACAAAAAGATTGATATATCCAG
CTCAGTCGTTCAACAAAAAATCAAAGAGCAATACACAAAAAGATTAAAGGCTTAA