SecReT6
Protein ID: 197337818
SecReT6 ID300
T6SS typei1
Gene symbol-
Locus tagVFMJ11_A0807
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]879740..881065 [+]
Producttype VI secretion protein, family
NoteTssK
UniProt IDB5EUI8
KEGG IDvfm:VFMJ11_A0807
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-137, Aligned region: 19..440
Protein Sequence: 441 a.a.     [Download]
>gi|197337818|ref|YP_002158356.1| type VI secretion protein, family [Vibrio fischeri MJ11]
MSLYNPVVWQDGMFMKPQHFQQLDRFQGKQSGMLSGFESPLHWGIKRIEINTELLALGKIGITHAEGILQ
DRTPFDLPLHASLPEVKDVDASVANKVLYLCCPLPSERSELFGTGKDGARYSIHTQDAVDACYDSEEIAN
ITIGKLNFCLMYEDEDKSAYTSIPILKISEVKPDGSIILDNAYIPTCIDINASTVLKKFTTEFASMLRHR
AESIVQRLGVVDQQGVSSVSDFMLLQALNRYEPLFWHFANIEGVHPEAFYRVLLQAEGELATLCSSSRRP
QEFVPYNHGNLTSCLSTILHNSKVTLSVMSEQRAIPLPLKEQGYGIRIAPISDRSIVESTTFILAVKADV
TLDILHTQFVSQTKIGSIDNIRELINLQLPGINIKPMPVVPRALPYHAGYTYFELDKSSEEWAALNKAAA
IAVHVAGDFANLSLQLWAVRL
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|197336667|ref|NC_011186.1|:879740-881065 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGTCATTATATAACCCTGTCGTTTGGCAAGATGGAATGTTCATGAAACCGCAACATTTCCAGCAGCTAG
ATCGCTTTCAAGGTAAACAAAGTGGAATGCTAAGTGGGTTTGAATCACCTCTTCACTGGGGCATAAAGCG
CATTGAAATTAATACCGAGTTACTGGCTTTAGGAAAAATTGGTATCACACACGCAGAAGGTATCTTGCAA
GATAGAACCCCTTTTGATTTACCACTGCACGCTTCTTTACCAGAGGTAAAAGATGTCGATGCATCCGTTG
CGAATAAAGTGCTGTACCTATGCTGCCCATTGCCTTCTGAACGTTCAGAATTATTTGGTACAGGTAAAGA
TGGTGCTCGCTATTCTATACACACACAAGATGCAGTAGACGCGTGTTATGACAGTGAAGAAATTGCCAAT
ATTACCATTGGTAAACTGAATTTTTGTTTAATGTATGAAGATGAAGATAAGAGTGCTTACACCTCTATTC
CAATCTTAAAAATTTCAGAAGTAAAACCAGATGGCAGTATTATTCTTGATAATGCTTACATCCCTACATG
TATTGATATCAACGCATCTACGGTATTAAAGAAATTTACTACTGAATTTGCCTCCATGCTTCGTCATCGT
GCTGAATCCATTGTGCAACGCTTAGGTGTGGTTGATCAGCAAGGTGTTTCATCGGTTTCTGATTTCATGC
TACTTCAAGCATTAAACCGTTATGAACCTTTATTCTGGCACTTTGCCAACATTGAAGGCGTACACCCTGA
AGCGTTTTATCGTGTTTTATTGCAAGCAGAAGGTGAATTAGCAACCCTATGTTCGTCGTCACGCCGACCA
CAAGAATTCGTTCCTTATAATCACGGTAATTTAACGAGTTGTTTATCAACCATCTTACATAACTCGAAAG
TGACCTTAAGCGTAATGTCAGAACAACGCGCTATTCCTCTTCCTCTTAAAGAGCAAGGTTATGGTATTCG
TATTGCGCCAATTTCAGACAGAAGTATCGTTGAATCAACTACCTTTATCTTGGCAGTTAAAGCTGACGTT
ACTCTTGATATACTACATACTCAGTTTGTATCTCAAACTAAGATTGGCTCTATCGATAACATTCGTGAAC
TTATCAATCTACAACTGCCAGGTATCAATATTAAACCTATGCCGGTGGTTCCTCGTGCATTGCCATATCA
CGCGGGATACACCTACTTTGAGTTAGATAAATCAAGCGAAGAATGGGCGGCACTAAATAAAGCCGCAGCA
ATTGCCGTTCATGTTGCAGGTGATTTTGCAAACTTATCTCTACAGCTTTGGGCCGTTAGACTATGA